Align D-xylonate dehydratase YagF; EC 4.2.1.82 (characterized)
to candidate GFF5251 PS417_26890 dihydroxy-acid dehydratase
Query= SwissProt::P77596 (655 letters) >FitnessBrowser__WCS417:GFF5251 Length = 613 Score = 195 bits (495), Expect = 6e-54 Identities = 159/517 (30%), Positives = 236/517 (45%), Gaps = 49/517 (9%) Query: 88 GHWEIGMQMQAAAKEITRNGGIPFAAFVSDPCDGRSQGTHGMFDSLPYRNDAAIVFRRLI 147 GH + Q A+EI R GG+ DG + G GM SLP R A ++ Sbjct: 49 GHVHLKDLGQLVAREIERAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSREIIADSVEYMV 108 Query: 148 RSLPTRRAVIGVATCDKGLPATMIALAAMHDLPTILVPGGA-----TLPPTVGEDAGKVQ 202 + A++ ++ CDK P ++A ++ +P I V GG T + G D Sbjct: 109 NA-HCADAIVCISNCDKITPGMLMAALRLN-IPVIFVSGGPMEAGKTKLASHGLDLVDAM 166 Query: 203 TIGARFANHELSLQEAAELGCRACASPGGGCQFLGTAGTSQVVAEALGLALPHSALAPSG 262 I A + + + E C C G C + TA + + EALGLALP + + Sbjct: 167 VIAADSSASDEKVAEYERSACPTC----GSCSGMFTANSMNCLVEALGLALPGNGSTLAT 222 Query: 263 QAVWLEIARQSARAVSELDSR-------GITTRDILSDKAIENAMVIHAAFGGSTNLLLH 315 + ++ Q+ R + EL R + R+I + KA ENAM + A GGSTN +LH Sbjct: 223 HSDREQLFLQAGRTIVELCKRYYGENDESVLPRNIANFKAFENAMTLDIAMGGSTNTILH 282 Query: 316 IPAIAHAAGCTIPDVEHWTRINRKVPRLVSVLPNGPDYHPTVRAFLAGGVPEVMLHLRDL 375 + A A A D+ R++R VP+L V PN YH AGG+ ++ L Sbjct: 283 LLAAAQEAEIEF-DLRDIDRLSRHVPQLCKVAPNIQKYH-MEDVHRAGGIFSILGSLARG 340 Query: 376 GLLHLDAMTVTGQTVGENLEWWQASE------------------RRARFRQCLR--EQDG 415 GLLH D TV +++ E + W ++ + F Q R D Sbjct: 341 GLLHTDLPTVHSKSIAEGIAKWDITQTDDEAVHTFFKAGPAGIPTQTAFSQSTRWDTLDD 400 Query: 416 VEPDDVILPPEKAKAKGLTSTVCFPTGNIAPEGSVIKATAIDPSVVGEDGVYHHTGRVRV 475 + I E A +K V + GNIA +G V+K +D S ++ G ++ Sbjct: 401 DRENGCIRSVEHAYSKEGGLAVLY--GNIALDGCVVKTAGVDES------IHVFEGNAKI 452 Query: 476 FVSEAQAIKAIKREEIVQGDIMVVIGGGP-SGTGMEETYQLTSALKHISWGKTVSLITDA 534 F S+ A++ I +E+ GDI+++ GP G GM+E TS LK GK +L+TD Sbjct: 453 FESQDSAVRGILADEVKAGDIVIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALLTDG 512 Query: 535 RFSGVSTGACFGHVSPEALAGGPIGKLRDNDIIEIAV 571 RFSG ++G GH SPEA AGG IG ++D D + I + Sbjct: 513 RFSGGTSGLSIGHASPEAAAGGAIGLVQDGDKVLIDI 549 Lambda K H 0.319 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 933 Number of extensions: 39 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 655 Length of database: 613 Length adjustment: 38 Effective length of query: 617 Effective length of database: 575 Effective search space: 354775 Effective search space used: 354775 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory