Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate GFF2165 PS417_11045 3-oxoacyl-ACP reductase
Query= reanno::Korea:Ga0059261_1894 (259 letters) >FitnessBrowser__WCS417:GFF2165 Length = 255 Score = 221 bits (562), Expect = 2e-62 Identities = 112/249 (44%), Positives = 157/249 (63%), Gaps = 1/249 (0%) Query: 11 AVYPSLKGKRVLVTGGGSGIGAGIVEGFARQGADVTFFDIAGAESQLLVERLSADGHKAC 70 AVYP L+GK VL++GG SGIG +V FA QGA V F D A ++ + L LS+ GH Sbjct: 6 AVYPDLEGKTVLISGGASGIGEFMVRAFAAQGAKVGFVDRAQSQGERLAALLSSRGHTVE 65 Query: 71 FERVDLTDVASLQAVIARLIKGAGGFDILVNNAANDDRHAIDEITEAYWDERLSVNLKHI 130 F D+TD + +A I R G +LVNNAAND RH ++E+ +D ++VNLKH Sbjct: 66 FVNCDITDEIAYKAAIGRFEHSLGPISVLVNNAANDARHTLEEVDSEMFDRLIAVNLKHA 125 Query: 131 FFCAQAVVPAMRARGGGAIVNLGSISWHLGLSDLVLYQTCKAAIEGLTRSLARDLGRDGI 190 FF A+AVVP M++ GGGAI+NLGS+ W + + +Y KAA G+TR+LAR+LG I Sbjct: 126 FFAAKAVVPMMKSAGGGAIINLGSVGWMMASAGYPVYAASKAAAHGMTRALARELGPSRI 185 Query: 191 RATCVIPGNVRTPRQLKWYSPEGEAEIVA-AQCLDGRLAPEDVAAMVLFLASDDARLVTG 249 R ++PG V T +QL + + E+++ +QCL G + PE +A M LFLASD + + + Sbjct: 186 RVNTLVPGWVMTEKQLAMWVDDAAKELISRSQCLPGSVLPEHIANMALFLASDASAMCSA 245 Query: 250 HSYFVDAGW 258 ++ VD GW Sbjct: 246 QNFIVDGGW 254 Lambda K H 0.321 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 255 Length adjustment: 24 Effective length of query: 235 Effective length of database: 231 Effective search space: 54285 Effective search space used: 54285 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory