Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate GFF2696 PS417_13755 oxidoreductase
Query= BRENDA::B8H1Z0 (248 letters) >FitnessBrowser__WCS417:GFF2696 Length = 249 Score = 113 bits (283), Expect = 3e-30 Identities = 81/248 (32%), Positives = 121/248 (48%), Gaps = 14/248 (5%) Query: 9 LKGKRVVITGGGSGIGAGLTAGFARQGAEVIFLDIADEDSRALEAELAGSPIPPVYKRCD 68 L GK V+TGG SGIG FA +GA+V+ + ++ L+ LA + + D Sbjct: 4 LNGKIAVVTGGNSGIGLATAIRFATEGAQVVIVGRRQDE---LDKALALIGHEAIAIQGD 60 Query: 69 LMNLEAIKAVFAEI----GDVDVLVNNAGNDDRHKLADVTGAYWDERINVNLRHMLFCTQ 124 + L+ + +F +I G VDVL NAG D + +T +D +N++ LF Q Sbjct: 61 ISKLDDLARIFTQIKADKGRVDVLFANAGLGDFQPIGSITEESFDRTFGINVKGTLFTVQ 120 Query: 125 AVAPGMKKRGGGAVINFGSISWHLGLEDLVLYETAKAGIEGMTRALARELGPDDIRVTCV 184 P M G +VI GS + +G +Y KA + R+ A +L IRV + Sbjct: 121 NALPLM--HAGSSVILTGSTTGTMGTPAFSVYSATKAALRNFARSWALDLKGSGIRVNVL 178 Query: 185 VPGNVKTKRQEKWYTPEGEAQIV----AAQCLKGRI-VPENVAALVLFLASDDASLCTGH 239 PG + T + + G+ + + AQ GRI PE VAA LFLASD++S TG Sbjct: 179 SPGPISTPGLDLALSGTGQKEAIIDDMTAQVPLGRIGKPEEVAAAALFLASDESSFMTGS 238 Query: 240 EYWIDAGW 247 E ++D G+ Sbjct: 239 EMFVDGGF 246 Lambda K H 0.319 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 249 Length adjustment: 24 Effective length of query: 224 Effective length of database: 225 Effective search space: 50400 Effective search space used: 50400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory