Align Xylonolactonase (EC 3.1.1.68) (characterized)
to candidate GFF1427 PS417_07255 calcium-binding protein
Query= reanno::Korea:Ga0059261_1893 (295 letters) >FitnessBrowser__WCS417:GFF1427 Length = 292 Score = 153 bits (386), Expect = 5e-42 Identities = 94/265 (35%), Positives = 131/265 (49%), Gaps = 9/265 (3%) Query: 20 EGPVWVQRDAALWFVDIKSHRIHRFDPASGERRSWDAPAQVGFCLPAANGKF-VAGLQTG 78 EGPVW L+++D RI R E R+W+ ++G +G+ + LQ G Sbjct: 15 EGPVWDVEQQRLYWIDSADGRILRCTDDGRELRAWEVGQKIGSMALRQDGESAIVALQNG 74 Query: 79 LAIFDPADRSFTPLTDPEPALPGNRLNDGTVDPAGRLWFGTMDDGESEATGRIYRLGGDG 138 + D + DPEP LP NRLNDG VD GR FG+MD E A+ ++YRL D Sbjct: 75 VHTLDLKSGELNLIADPEPHLPDNRLNDGKVDRQGRFIFGSMDTQEDNASAKLYRLDADL 134 Query: 139 RCVAETAAVSISNGPAVSPDGRTLYHVDTLGGVI----HSAAIGDDGILGDSRVFATI-P 193 + +SNGP SP G T Y DT G I + A G+ + + R FA + Sbjct: 135 SLHTLDEGIIVSNGPCWSPSGDTFYFCDTWSGEIWAYDYDLATGN---VSNRRTFAKVDT 191 Query: 194 NSEGFPDGPAVDAEGCVWIGLYNGAAVRRYSPAGELLDVVAFPVGAITKVAFGGPDLRTV 253 G DG VDAEGC+W L + RY+P G + ++ PV +T + FGGP+L T+ Sbjct: 192 RGGGAADGCTVDAEGCLWQALVYAGKLVRYTPEGVVDRIIQMPVKKVTSLTFGGPNLDTL 251 Query: 254 YATTASKHLDADGRAEEPHAGDLFA 278 + T+ +K A+ G LFA Sbjct: 252 FVTSMAKPPLPRFPADGQQRGALFA 276 Lambda K H 0.319 0.139 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 292 Length adjustment: 26 Effective length of query: 269 Effective length of database: 266 Effective search space: 71554 Effective search space used: 71554 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory