GapMind for catabolism of small carbon sources

 

Aligments for a candidate for xylK_Tm in Pseudomonas simiae WCS417

Align Ribose import ATP-binding protein RbsA 1; EC 7.5.2.7 (characterized, see rationale)
to candidate GFF3463 PS417_17730 ribonucleotide-diphosphate reductase subunit alpha

Query= uniprot:Q9WXX0
         (520 letters)



>lcl|FitnessBrowser__WCS417:GFF3463 PS417_17730
           ribonucleotide-diphosphate reductase subunit alpha
          Length = 502

 Score =  396 bits (1018), Expect = e-115
 Identities = 213/502 (42%), Positives = 322/502 (64%), Gaps = 14/502 (2%)

Query: 14  ILKAKGIVKRFPGVVAVDNVDFEVYENEIVSLIGENGAGKSTLIKILTGVLKPDAGEILV 73
           +LK + I KR+PGV A+ +++ +V   EI +L+GENGAGKSTL+KIL GV   D G+IL+
Sbjct: 4   LLKLENICKRYPGVQALKSINLQVERGEIHALLGENGAGKSTLMKILGGVEHQDEGQILI 63

Query: 74  NGERVEFHSPVDAFKKGISVIHQELNLCDNMTVAENIFLAYEAVRGQKRTLSSR---VDE 130
           +G+  +F +  DA   GI ++ QE +L   +T  ENIFL +E        LS+R   + +
Sbjct: 64  DGQAQQFATYRDAIAAGIGIVFQEFSLIPYLTAVENIFLGHE--------LSNRFGLLRK 115

Query: 131 NYMYTRSKELLDLIGAKFSPDALVRNLTTAQRQMVEICKALVKEPRIIFMDEPTSSLTVE 190
             M   S+ L   +G        V++L+ A++Q VEI KAL  + R++ +DEPT++LT  
Sbjct: 116 REMVEASEALFKRLGVTIDLQCAVKHLSVAEQQFVEIAKALALDARLLVLDEPTATLTPS 175

Query: 191 ETERLFEIIEMLKSRGISVVFVSHRLDEVMRISDRIVVMRDGKRIGELKKGEFDVDTIIK 250
           E E LFEI+  LK +G++V+F+SH L+E+ ++ DRI V+RDG  +G     + D+D +++
Sbjct: 176 EAELLFEIMRELKRQGVAVIFISHHLEEIFQVCDRISVLRDGGNVGVTDVADSDIDHLVE 235

Query: 251 MMVGREVEF-FPHGIETRPGEIALEVRNLKWKDKVKNVSFEVRKGEVLGFAGLVGAGRTE 309
           MMVGR +   FP       G + LEV++++      +  F++ KGE+LGFAGLVG+GRTE
Sbjct: 236 MMVGRRLACSFPPKPTRERGPLLLEVKDIQLVRNGPHNRFQLHKGEILGFAGLVGSGRTE 295

Query: 310 TMLLVFGVNQKESGDIYVNGRKVEIKNPEDAIKMGIGLIPEDRKLQGLVLRMTVKDNIVL 369
             L + G     S D+++ G K+ + +P  A+  GIGL+PE RK +GL+   ++++NI L
Sbjct: 296 LALGMMGALPSVSKDVWLRGEKITLDDPAQALAHGIGLLPESRKSEGLITDFSIRENISL 355

Query: 370 PSLKKISRWGLVLDERKEEEISEDYVKRLSIKTPSIYQITENLSGGNQQKVVLAKWLATN 429
            +L K      ++D+ +E    E  +K+LSIK PS      NLSGGNQQKVV+A+W+  +
Sbjct: 356 NNLPKYQNASGLIDKNRECASVEGLMKQLSIKAPSSESRVFNLSGGNQQKVVIARWINHH 415

Query: 430 ADILIFDEPTRGIDVGAKAEIHRMIRELAAQGKAVIMISSELPEILNLSDRIVVMWEGEI 489
            D+L+FDEPTRGIDVGAKA+I+ ++R L  QG A+IMISSELPEI+ + DR+ V  +G I
Sbjct: 416 CDVLVFDEPTRGIDVGAKAQIYALMRSLTEQGYAIIMISSELPEIIGMCDRVAVFHKGAI 475

Query: 490 TAVLDNREKRVTQEEIMYYASG 511
             +L+     V  +E+M +A+G
Sbjct: 476 VKLLE--ASAVNPQEVMRHATG 495



 Score = 72.8 bits (177), Expect = 3e-17
 Identities = 49/229 (21%), Positives = 107/229 (46%), Gaps = 7/229 (3%)

Query: 35  FEVYENEIVSLIGENGAGKSTLIKILTGVLKPDAGEILVNGERVEFHSPVDAFKKGISVI 94
           F++++ EI+   G  G+G++ L   + G L   + ++ + GE++    P  A   GI ++
Sbjct: 275 FQLHKGEILGFAGLVGSGRTELALGMMGALPSVSKDVWLRGEKITLDDPAQALAHGIGLL 334

Query: 95  HQELN---LCDNMTVAENIFLAYEAVRGQKRTLSSRVDENYMYTRSKELLDLIGAKF-SP 150
            +      L  + ++ ENI L       + +  S  +D+N      + L+  +  K  S 
Sbjct: 335 PESRKSEGLITDFSIRENISLNNLP---KYQNASGLIDKNRECASVEGLMKQLSIKAPSS 391

Query: 151 DALVRNLTTAQRQMVEICKALVKEPRIIFMDEPTSSLTVEETERLFEIIEMLKSRGISVV 210
           ++ V NL+   +Q V I + +     ++  DEPT  + V    +++ ++  L  +G +++
Sbjct: 392 ESRVFNLSGGNQQKVVIARWINHHCDVLVFDEPTRGIDVGAKAQIYALMRSLTEQGYAII 451

Query: 211 FVSHRLDEVMRISDRIVVMRDGKRIGELKKGEFDVDTIIKMMVGREVEF 259
            +S  L E++ + DR+ V   G  +  L+    +   +++   G   E+
Sbjct: 452 MISSELPEIIGMCDRVAVFHKGAIVKLLEASAVNPQEVMRHATGGSSEY 500


Lambda     K      H
   0.319    0.138    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 645
Number of extensions: 32
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 520
Length of database: 502
Length adjustment: 35
Effective length of query: 485
Effective length of database: 467
Effective search space:   226495
Effective search space used:   226495
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory