GapMind for catabolism of small carbon sources

 

Protein Ac3H11_2942 in Acidovorax sp. GW101-3H11

Annotation: FitnessBrowser__acidovorax_3H11:Ac3H11_2942

Length: 279 amino acids

Source: acidovorax_3H11 in FitnessBrowser

Candidate for 8 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-sorbitol (glucitol) catabolism mtlG hi ABC transporter for D-Sorbitol, permease component 1 (characterized) 100% 100% 548.5
D-mannitol catabolism mtlG med MtlG, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) 62% 98% 354.4 ABC transporter for D-Sorbitol, permease component 1 100% 548.5
xylitol catabolism Dshi_0549 lo ABC transporter for Xylitol, permease component 2 (characterized) 33% 100% 186.8 ABC transporter for D-Sorbitol, permease component 1 100% 548.5
trehalose catabolism thuG lo ABC-type transporter, integral membrane subunit, component of Trehalose porter. Also binds sucrose (Boucher and Noll, 2011). Induced by glucose and trehalose. Directly regulated by trehalose-responsive regulator TreR (characterized) 32% 95% 141.4 ABC transporter for D-Sorbitol, permease component 1 100% 548.5
sucrose catabolism thuG lo Sugar ABC transporter permease (characterized, see rationale) 32% 99% 139.8 ABC transporter for D-Sorbitol, permease component 1 100% 548.5
xylitol catabolism HSERO_RS17010 lo ABC-type sugar transport system, permease component protein (characterized, see rationale) 31% 97% 133.3 ABC transporter for D-Sorbitol, permease component 1 100% 548.5
D-maltose catabolism thuG lo ABC transporter for D-Trehalose, permease component 2 (characterized) 30% 98% 131.7 ABC transporter for D-Sorbitol, permease component 1 100% 548.5
D-maltose catabolism malG lo ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) (characterized) 36% 72% 106.7 ABC transporter for D-Sorbitol, permease component 1 100% 548.5

Sequence Analysis Tools

View Ac3H11_2942 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MTVRRRSNFPLGLLALRTAAAWGVALLLFFPLGWLFLTAFKTELQAIAVPPLFVFTPTLE
NFHEVQERSDYLLYAKNSVITSVLSTVLGLMLAAPAAYAMAFFKGKYTKDILMWMLSTKM
MPAVGALVPIYVLAQKSHLLDTQLALIIVFALSNLPIMVWMLYSHFKDIPHEILEAARMD
GATLWQEVRLVLLPLGMGGLASTGLLCLVLSWNEAFWSLNLSAAKAGTLATLIASYSSPE
GLFWAKLSAASLMAIAPIVVFGWFSQKQLVQGLTFGAVK

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory