GapMind for catabolism of small carbon sources

 

Protein Ac3H11_3326 in Acidovorax sp. GW101-3H11

Annotation: FitnessBrowser__acidovorax_3H11:Ac3H11_3326

Length: 260 amino acids

Source: acidovorax_3H11 in FitnessBrowser

Candidate for 38 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-glucosamine (chitosamine) catabolism AO353_21715 lo ABC transporter for D-Glucosamine, permease component 2 (characterized) 39% 91% 128.6 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-arginine catabolism artQ lo Probable permease of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 37% 90% 126.3 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-histidine catabolism hisQ lo Probable permease of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 37% 90% 126.3 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-lysine catabolism hisQ lo Probable permease of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 37% 90% 126.3 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-histidine catabolism Ac3H11_2554 lo ABC transporter for L-Histidine, permease component 1 (characterized) 32% 96% 122.1 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-arginine catabolism artM lo AotP aka AotM aka PA0890, component of Arginine/ornithine (but not lysine) porter (characterized) 32% 93% 121.3 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-citrulline catabolism PS417_17595 lo ABC transporter permease subunit; SubName: Full=Amino acid ABC transporter permease; SubName: Full=Histidine transport system permease protein (characterized, see rationale) 34% 91% 116.7 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-glutamate catabolism gluD lo GluD aka CGL1953, component of Glutamate porter (characterized) 34% 76% 115.5 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-asparagine catabolism natG lo NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 32% 83% 114.8 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-aspartate catabolism natG lo NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 32% 83% 114.8 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-citrulline catabolism AO353_03045 lo ABC transporter for L-Arginine and L-Citrulline, permease component 2 (characterized) 31% 90% 114.4 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-lysine catabolism hisM lo Amino acid ABC transporter, membrane protein (characterized, see rationale) 34% 97% 110.9 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-asparagine catabolism aatQ lo ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 2 (characterized) 31% 93% 109.4 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-aspartate catabolism aatQ lo ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 2 (characterized) 31% 93% 109.4 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-glutamate catabolism gltJ lo ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 2 (characterized) 31% 93% 109.4 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-asparagine catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 62% 109 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-aspartate catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 62% 109 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-glutamate catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 62% 109 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-histidine catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 62% 109 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-leucine catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 62% 109 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-proline catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 62% 109 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-citrulline catabolism AO353_03050 lo ABC transporter for L-Arginine and L-Citrulline, permease component 2 (characterized) 33% 94% 107.8 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-histidine catabolism hisM lo Histidine transport system permease protein HisM (characterized) 30% 88% 107.1 Basic amino acid uptake transporter, BgtAB 41% 152.9
D-alanine catabolism Pf6N2E2_5404 lo ABC transporter for D-Alanine, permease component 1 (characterized) 33% 59% 105.5 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-asparagine catabolism aapQ lo AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 36% 61% 104.4 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-aspartate catabolism aapQ lo AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 36% 61% 104.4 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-glutamate catabolism aapQ lo AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 36% 61% 104.4 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-histidine catabolism BPHYT_RS24005 lo Polar amino acid ABC transporter, inner membrane subunit; Flags: Precursor (characterized, see rationale) 31% 94% 104.4 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-histidine catabolism aapQ lo AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 36% 61% 104.4 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-leucine catabolism aapQ lo AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 36% 61% 104.4 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-proline catabolism aapQ lo AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 36% 61% 104.4 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-citrulline catabolism PS417_17600 lo ABC transporter permease; SubName: Full=Amino acid ABC transporter permease; SubName: Full=Histidine ABC transporter permease HisM; SubName: Full=Histidine transport system permease protein; SubName: Full=Histidine/lysine/arginine/ornithine ABC transporter permease HisM (characterized, see rationale) 31% 92% 103.6 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-asparagine catabolism bztC lo BztC, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 32% 51% 94.4 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-aspartate catabolism bztC lo BztC, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 32% 51% 94.4 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-glutamate catabolism bztC lo BztC, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 32% 51% 94.4 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-asparagine catabolism bgtB' lo ABC-type permease for basic amino acids and glutamine (characterized, see rationale) 34% 53% 92 Basic amino acid uptake transporter, BgtAB 41% 152.9
L-aspartate catabolism bgtB' lo ABC-type permease for basic amino acids and glutamine (characterized, see rationale) 34% 53% 92 Basic amino acid uptake transporter, BgtAB 41% 152.9
D-alanine catabolism Pf6N2E2_5403 lo ABC transporter for D-Alanine, permease component 2 (characterized) 31% 54% 88.6 Basic amino acid uptake transporter, BgtAB 41% 152.9

Sequence Analysis Tools

View Ac3H11_3326 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MLTAFWPQRWSRQQRSNATLVSAVILMVLALALLGQLLSFLPEPIGSNAQAFSDGARTTL
WLTLISGSVGLVLGTGAALARTARWAVVRWAASFYIWVIRGTPLLVQILFVYFALPVLVP
GLNLPDFAAAVLALGLNVGAYNAEAIRAGLLAVPRGQTEAAKALGLGRMHVFFDVVFPQA
FKISLPPLVSNFVALLKDSSLAYAIGVVELTNVGNRIQSATFQPIATLSTVAITYLLLTT
LVTQISNAVEYRFDVEGRNK

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory