Align dicarboxylate TRAP transporter (succinate, fumarate, L-malate, and alpha-ketoglutarate), large permease component (characterized)
to candidate Ac3H11_3520 TRAP-type C4-dicarboxylate transport system, large permease component
Query= reanno::PV4:5208943 (465 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3520 Length = 426 Score = 237 bits (605), Expect = 5e-67 Identities = 144/456 (31%), Positives = 245/456 (53%), Gaps = 41/456 (8%) Query: 1 MTIATLFISLFLCMLLGMPIAIAL---GFSSMLTILLFSDDSLASVALKLYESTSEHYTL 57 MT+ SL M +G+PIA AL G + M + LF LA + + ++ + L Sbjct: 1 MTVFIFLGSLLAAMAIGVPIAYALLVSGAALMWHLDLFDAQILAQNVI----NGADSFPL 56 Query: 58 LAIPFFILSSAFLSTGGVARRIIDFAMDSVGHIRGGLAMASVMACMLFAAVSGSSPATVA 117 LA+PFF+L+ ++ GG+++RI+ A+ VGH RGGL +++A + AA+SGS+ A A Sbjct: 57 LAVPFFMLAGEIMNVGGLSQRIVKLALTLVGHKRGGLGFVAILAACMLAALSGSAVADTA 116 Query: 118 AIGSIVIVGMVRAGYPEKFAAGVITTSGTLGILIPPSIVMLVYAAATEVSAARMFMAGLI 177 A+ ++++ MV+AG+ + A G+I ++G + +IPPSI +V+ A VS +++F+AG++ Sbjct: 117 ALAALLLPMMVKAGHDKARAGGLIASAGIIAPVIPPSIGFVVFGVAANVSISKLFLAGIV 176 Query: 178 PGLMMGLLLMLAIYIVARIKKLPSRPFPGFRPLAISSAKAMGGLALIVIVLGSIYGGIAS 237 PGL+MG+ + + Y V++ + + P + ++ L L VIV+ + G+ + Sbjct: 177 PGLLMGVAIAVTWYWVSQRENVTPPPKASTAEKLQALKESTWALFLPVIVIVGLKMGVFT 236 Query: 238 PTEAAAVACVYAYFIAVFGYRDIGPLKNVSWRDSGEPLIRAILRNLGFMVLAVFKTPADK 297 PTEAAAVA VYA +A YR++ WR + I A Sbjct: 237 PTEAAAVAAVYALLVATLVYREL------HWRQLTDVFISA------------------- 271 Query: 298 EIRHVVRDGAKVSIMLLFIIANAMLFAHVLTTERIPHLIAETIVGMGLPVWGFLIIVNLL 357 AK + +++F++A AM+ A ++T IP + + + LI + +L Sbjct: 272 ---------AKTTAVIMFLVAAAMVSAWLITVADIPRQLVSLLKPLMEHPTLLLIAIMVL 322 Query: 358 LLAAGNFMEPSAILLIMAPILFPIATQLGIDPIHLGIIMVVNMEIGMLTPPVGLNLFVTA 417 ++A G M+ + +LI+ P+L P+ GIDP++ G++ ++N IG++TPPVG L V A Sbjct: 323 VMAVGTAMDMTPTILILTPVLMPVVKAAGIDPVYFGVLFIMNNAIGLITPPVGTVLNVVA 382 Query: 418 GITGRSMGWVIHSCIPWLALLLFFLALITYIPQISL 453 G+ M V IP++A + L+ P I L Sbjct: 383 GVGKMRMDEVTRGVIPFMAAQFAMMFLMVLFPSIVL 418 Lambda K H 0.330 0.144 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 520 Number of extensions: 32 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 465 Length of database: 426 Length adjustment: 32 Effective length of query: 433 Effective length of database: 394 Effective search space: 170602 Effective search space used: 170602 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory