Align alpha-ketoglutarate TRAP transporter, large permease component (characterized)
to candidate Ac3H11_4175 TRAP-type C4-dicarboxylate transport system, large permease component
Query= reanno::SB2B:6938090 (466 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4175 Length = 421 Score = 234 bits (598), Expect = 3e-66 Identities = 139/455 (30%), Positives = 253/455 (55%), Gaps = 39/455 (8%) Query: 3 IATLFLTLFLCMLLGMPIAIALGFSSMLTILLFSNDSL-ASVALKLYEATSEHYTLLAIP 61 I TLF +++G+PI + L S + IL + L S ++++ + Y L+AIP Sbjct: 2 ITTLFF--LAALMVGVPIGVCLCLSGAVYILSIGSPVLFQSFPMQMFGGV-DSYGLIAIP 58 Query: 62 FFILSSAFLSTGGVARRIIDFAMDSVGHIRGGLAMASVMACMLFAAVSGSSPATVAAIGS 121 FIL +++GG+ RR++D +M +G ++GGLA +++A ML +++ GS+ A VA + Sbjct: 59 LFILIGEIMNSGGITRRLVDLSMAFIGSVKGGLAYVNILANMLVSSIIGSATAQVAIMSQ 118 Query: 122 IVIVGMVRAGYPQKFAAGVITTSGTLGILIPPSIVMLVYAAATEVSAARMFMAGLIPGLL 181 +++ M + GY + FAAG+ G LG +IPPS++ +VY+ +V+ M +AG++PG+L Sbjct: 119 VMVPEMEKQGYDKTFAAGLTVYGGMLGPIIPPSVMFVVYSVLAQVAVGDMLIAGILPGVL 178 Query: 182 MGVLLMVAIYIVARIKNLPSRPFPGVKALSLSSAKAMGGLALIFIVLGSIYGGVASPTEA 241 + +L V I ++ + N P + + + +A L + I++GSI G+A+PTE+ Sbjct: 179 LTLLFFVVIALMGFVYNYPRSEKRTLAQRARTVVQASPTLLIPIIIVGSILSGLANPTES 238 Query: 242 AAVACVYAYLVAVFGYRDIGPLKEVPWRKEGEAILAAIVRNLLHVGLGLIKTPTDKEIRN 301 AAV + + LV + ++ A+ A ++R+ ++ Sbjct: 239 AAVGALASALVGRYVTKEF----------RFSAMPAILLRSAIY---------------- 272 Query: 302 VVRDGAKVSIMLLFIIANAMLFAHVLTTERIPHIIAETIVGWGLPPWGFLIIVNLLLLAA 361 S ++LF++A A +F+ +L ++P ++A + P FL++ N++LL Sbjct: 273 --------SAIVLFLVAAAAVFSWLLIYGKVPQMVAAWVQTVAHDPVTFLLLTNVILLVI 324 Query: 362 GNFMEPSAILLIMAPILFPIAVQL-GIDPIHLGIIMVVNMEIGMLTPPVGLNLFVTAGIT 420 G ++ L++ APIL PIA ++ IDP H G+++VVN+ +G++TPPVGL+ FV + +T Sbjct: 325 GTVIDGIPGLIMTAPILLPIATEVYHIDPRHFGVVIVVNLVLGLMTPPVGLSFFVASAVT 384 Query: 421 GRSIGWVIHACLPWLLLLLGFLVLITYVPQISLFL 455 G G + LP+ ++ LV+++ P +SL L Sbjct: 385 GAKPGKMFIVTLPFFIISCVALVMLSLFPSLSLGL 419 Lambda K H 0.329 0.144 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 580 Number of extensions: 35 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 466 Length of database: 421 Length adjustment: 32 Effective length of query: 434 Effective length of database: 389 Effective search space: 168826 Effective search space used: 168826 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory