Align C4-dicarboxylate-binding periplasmic protein DctP (characterized)
to candidate Ac3H11_1227 TRAP-type C4-dicarboxylate transport system, periplasmic component
Query= SwissProt::A3QCW5 (336 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1227 Length = 334 Score = 146 bits (368), Expect = 8e-40 Identities = 97/322 (30%), Positives = 159/322 (49%), Gaps = 8/322 (2%) Query: 12 QIVKMTSIAALLGASLNSWAAPTE--IKFSHVVAENTPKGQMALKFKQLVEERLPGEYQV 69 +++K AL+ ASL A E IKF+ ++ P+ Q A KF LV + G V Sbjct: 2 KLLKTLLATALVAASLLPAAHAQERTIKFAFQNQKDHPQAQGAQKFADLVAAKTGGRIAV 61 Query: 70 NVFPNSQLFGDNNELSALLLNDVQFVAPSLSKFERYTKKLQLFDLPFLFKDMDAVNRFQQ 129 +FP L GD +SAL V+ + +K+ ++D PFLF + Sbjct: 62 KLFPGGTLGGDLQTVSALQGGTVEMTVLNAGILAAQSKEFGIYDFPFLFATPQEADAVTD 121 Query: 130 SDAGQQLLNSMKRKGVVGLGYLHNGMKQFSASS-PLVLPEDAQGKKFRIMASDVLAAQFQ 188 G++LL+ ++ K +VGLGY G + + S P+ ED G K R++ S + F Sbjct: 122 GPFGKKLLDKLQAKNLVGLGYWELGFRNLTNSKKPITKAEDIAGLKIRVIQSPIYIDLFN 181 Query: 189 AVEAIPVKKPFSEVFTLLQTRAIDGQENTWSNIYSKKFYEVQSNITESNHGVLDYMVVTS 248 A+ A V PF E++T ++ +A+DGQEN +S I S KF EVQ +T + H V+ S Sbjct: 182 ALGANAVPMPFPELYTAMEQKAVDGQENPFSTILSSKFAEVQKYLTVTRHMYNPQAVIVS 241 Query: 249 NTFWKSLPADKRKVIKASLDEAIAYGNEIAAAKVNKDKQAIIDSKRS--EVTYLTPEQRA 306 FW SL +K + ++ EA + ++ + N A+ D K++ +V+ +P + Sbjct: 242 KKFWDSLNPADQKALTDAMAEATTFQRGVSRVQAN---VALEDLKKAGMQVSEFSPAELD 298 Query: 307 AWVNAMKPVWAQFEDKIGKDLI 328 +KPV + +K+G + + Sbjct: 299 KLRAKVKPVVEKHSEKVGAETV 320 Lambda K H 0.317 0.130 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 334 Length adjustment: 28 Effective length of query: 308 Effective length of database: 306 Effective search space: 94248 Effective search space used: 94248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory