Align Putative aldehyde dehydrogenase DhaS; EC 1.2.1.3 (characterized)
to candidate Ac3H11_1496 Aldehyde dehydrogenase (EC 1.2.1.3)
Query= SwissProt::O34660 (495 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1496 Length = 500 Score = 447 bits (1151), Expect = e-130 Identities = 228/486 (46%), Positives = 310/486 (63%), Gaps = 12/486 (2%) Query: 16 LQGTKKL-------YIDGKFVPSASGATFDTPNPATGETLMTLYEAQAADVDKAVKAARK 68 LQG K L I G P+ SG +PAT + ++ AAD+ +AV +A++ Sbjct: 11 LQGAKFLSERRVGNVIGGVSGPALSGRWLPVTDPATEMVVAEAPDSDAADIARAVASAQR 70 Query: 69 AFDQGEWRTMSPASRSRLMYKLADLMEEHKTELAQLETLDNGKPINETTNGDIPLAIEHM 128 AFD WR + PA R +L+++L++L+E H EL+ LETL +GK D+ E + Sbjct: 71 AFDSHVWRGLRPADREKLLFRLSELIERHADELSALETLQSGKLQGIARAIDVQAGAEFV 130 Query: 129 RYYAGWCTKITGQT----IPVSGA-YFNYTRHEPVGVVGQIIPWNFPLLMAMWKMGAALA 183 RY AGW TK+ GQT IP+ G + YTR EPVGVVG I+PWNFPL +A+WK+ ALA Sbjct: 131 RYMAGWATKLEGQTLDNSIPIPGPQWVTYTRREPVGVVGAIVPWNFPLAIALWKIAPALA 190 Query: 184 TGCTIVLKPAEQTPLSALYLAELIDQAGFPAGVINIIPGFGEDAGEALTNHEAVDKIAFT 243 GCT+VLKP+E TPL+AL LA L +AG P GV+N++ G G AG AL H V K++FT Sbjct: 191 AGCTVVLKPSEDTPLTALRLAHLALEAGIPEGVLNVVCGRGATAGAALIAHPGVRKLSFT 250 Query: 244 GSTEIGKKIMSTAAKSIKRVTLELGGKSPNILLPDANLKKAIPGALNGVMFNQGQVCCAG 303 GST +GK + A +++ R TLELGGKSP +++ DA+ + G G+ F+QGQVC A Sbjct: 251 GSTAVGKVVGHAAVENMARFTLELGGKSPAVVMEDADPSQVAQGIATGIFFHQGQVCTAS 310 Query: 304 SRVFIHKDQYDEVVDEMASYAESLRQGAGLHKDTQIGPLVSKEQHERVLSYIQKGKDEGA 363 SR+ +H+ Y V+DE+A A+ +R G+G TQ GPL SK RV+ +I K EGA Sbjct: 311 SRLLVHRSLYRRVLDELAGIAQGMRIGSGFDAATQFGPLTSKAHFARVMDFIASAKAEGA 370 Query: 364 KAVTGGSCPFEAGYFVAPTVFANVEDEMTIAKEEIFGPVLTAIPYETVDEVIERANHSEY 423 V GG +AG FV PT+FA+ +M + +EE+FGPVL P++ V++ I AN + Y Sbjct: 371 TLVAGGERVHDAGCFVQPTIFADTTAQMRVVREEVFGPVLAVAPFDDVEDAIAAANDTPY 430 Query: 424 GLAAGLWTENVKQAHYIADRLQAGTVWVNCYNVFDAASPFGGYKQSGLGREMGSYALDNY 483 GLAA LWT+++ AH I RLQAG VWVN +NV DA P GG KQSG GR++G A++ + Sbjct: 431 GLAASLWTQSLSHAHRIVPRLQAGVVWVNAHNVLDAGLPLGGIKQSGTGRDLGRAAVEGF 490 Query: 484 TEVKSV 489 TE+KSV Sbjct: 491 TELKSV 496 Lambda K H 0.316 0.133 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 617 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 500 Length adjustment: 34 Effective length of query: 461 Effective length of database: 466 Effective search space: 214826 Effective search space used: 214826 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory