Align cyclohexa-1,5-dienecarbonyl-CoA hydratase (EC 4.2.1.100) (characterized)
to candidate Ac3H11_2775 Enoyl-CoA hydratase (EC 4.2.1.17)
Query= BRENDA::O87873 (258 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2775 Length = 279 Score = 85.5 bits (210), Expect = 1e-21 Identities = 81/259 (31%), Positives = 127/259 (49%), Gaps = 10/259 (3%) Query: 3 EASSPLK-VWLERDGSLLRLRLARP-KANIVDAAMIAAMRQALGEHLQAPALRAVLLDAE 60 EA++P V +ER G + + L RP + N ++ + + AL E P++R +++ Sbjct: 16 EAAAPGNAVEVERRGGVGWIVLNRPDQINAINDDIRRGVPAALAELDSDPSVRVIVIRGA 75 Query: 61 GPH-FSFGASVDEHMPDQCAQMLKSLHGLVR--EMLD-SPVPILVALRGQCLGGGLEVAA 116 G F GA + E + + ++ R E LD + P++ A+ G C+GGG+E+A Sbjct: 76 GARGFCAGADIKERRAAETSVQVRRRMQKSRWIEALDRTEKPVIAAIHGYCMGGGMELAL 135 Query: 117 AGNLLFAAPDAKFGQPEIRLGVF-APAASCLLPPRVGQACAEDLLWSGRSIDGAEGHRIG 175 A +L FAA DA F PE LG+ + L VG A DLL +G +D IG Sbjct: 136 ACDLRFAASDAVFALPETGLGLIPGGGGTQRLGAVVGPGRALDLLLTGDRVDARRAFDIG 195 Query: 176 LIDVLAEDPEA--AALRWFDEHIARLSASSLRFAVRAARCDSVPRIKQKLDTVEALYLEE 233 LI +A+ ++ A + E IA+ ++ FA +AAR +K LD +E Sbjct: 196 LITRMADSADSLLAEVTALAERIAQKPPTATLFAKQAARAACHLDLKSGLD-LELDLFAM 254 Query: 234 LMASHDAVEGLKAFLEKRS 252 L+ +D E AF EKR+ Sbjct: 255 LVPMNDVKEAALAFREKRA 273 Lambda K H 0.321 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 279 Length adjustment: 25 Effective length of query: 233 Effective length of database: 254 Effective search space: 59182 Effective search space used: 59182 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory