Align FcbT3, component of Tripartite 4-chlorobenzoate symporter (also binds and may transport 4-bromo-, 4-iodo-, and 4-fluorobenzoate and with a lower affinity, 3-chlorobenzoate, 2-chlorobenzoate, 4-hydroxybenzoate, 3-hydroxybenzoate, and benzoate) (characterized)
to candidate Ac3H11_2592 TRAP dicarboxylate transporter, DctM subunit, unknown substrate 5
Query= TCDB::Q9RBQ9 (439 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2592 Length = 434 Score = 233 bits (595), Expect = 7e-66 Identities = 130/386 (33%), Positives = 212/386 (54%), Gaps = 8/386 (2%) Query: 56 AVASFSLTPIPLFILMGELLFHTGLAQRAIDGIDKVIPRLPGRLAVIAVVAGTFFSAISG 115 + +S++LT +PLFI MGE+LF T L+Q G+ + LPGRL VV T F+A+SG Sbjct: 55 SASSWTLTALPLFIWMGEILFRTRLSQDMFKGLAPWVQALPGRLLHTNVVGCTIFAAVSG 114 Query: 116 STIATTAMLGSLMLPMMLARGYEPKLGMGPIIAIGGVDMLIPPSALAVLLGSLAGISISK 175 S+ AT A +G + LP + RGY + +G + + +LIPPS + ++ G A +SIS+ Sbjct: 115 SSAATCATIGKMTLPELTRRGYPEHMVVGTLAGASTLGLLIPPSIIMIVYGVSAEVSISQ 174 Query: 176 LLIGGVLPGLLLAISFVAYIVASAKLRPESAPREE--LVVLRGWERWRELVVYVLPLSLI 233 L I GVLPG+LLA F YI+ A P+ P + + ++ R L+ P+ L+ Sbjct: 175 LFIAGVLPGILLAALFSGYIMLWALRHPDQVPAADVRMTFMQKLAESRSLI----PVVLL 230 Query: 234 FVAIVAVISGGVATPTEAAAIGCAATLAITLMYRALRWQSLVQALQGTVAISGMILFIIV 293 A++ I G AT TEAAA+G +L ++ + ++ W + +L G + MI I+ Sbjct: 231 IAAVLGSIYTGFATATEAAAVGVVGSLILSAVQGSMNWGTFKASLMGATRLYCMIALILA 290 Query: 294 AATTFSQVLSFSGATNGIVDLVQSSGLPPAGVVAIMLAILIFLGLFVDQVSMMLLTLPFY 353 A + + + G + + + S GL A ++A + I LG F+D +SM++LT+ Sbjct: 291 GAAFLTLSMGYIGLPRHLAEWIASLGLNKAQLIAALAVFFIILGCFLDGISMVVLTMGVL 350 Query: 354 MPIVKSLGIDQIWFGVMYLICMQLGLLMPPHGMLLYTMKGVAPKHITMGQVFASAMPYVG 413 MP V++ GID IWFG+ ++ +++ + PP G L+ ++G+ + + + +P Sbjct: 351 MPTVQAAGIDPIWFGIFIVLVVEMAQITPPVGFNLFVLQGMTGRQLPW--IAKVTVPMFL 408 Query: 414 LSFTMLILIFFWPGIATWLPDVFVGR 439 L + LI+ +PGI TWLP R Sbjct: 409 LMCGAVALIYIFPGIVTWLPQQMAAR 434 Lambda K H 0.329 0.143 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 29 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 434 Length adjustment: 32 Effective length of query: 407 Effective length of database: 402 Effective search space: 163614 Effective search space used: 163614 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory