Align Benzoate--CoA ligase; Benzoyl-CoA synthetase; EC 6.2.1.25 (characterized)
to candidate Ac3H11_4478 Acetyl-coenzyme A synthetase (EC 6.2.1.1)
Query= SwissProt::Q8GQN9 (527 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4478 Length = 536 Score = 196 bits (499), Expect = 1e-54 Identities = 151/464 (32%), Positives = 214/464 (46%), Gaps = 39/464 (8%) Query: 94 GAIKGGVVPIAINTLLTESDYEYMLTDSAARVAVVSQELLPLFAPMLGKVPTLEHLVVA- 152 G K G + L E + EY LTD RV V + LLP+ + K L+H+ V Sbjct: 77 GIQKIGAIVCPCGPLNKEHELEYQLTDLQTRVIVAADVLLPVVDKVRAKT-ALQHVFVVR 135 Query: 153 -------GGAGEDSLAALL---------ATGSEQFEAAP---TRP-------DDHCFWLY 186 G D A LL G E F AA RP DD Y Sbjct: 136 YAELLPDGTPSIDVPAELLNMRTAMGSVPAGCEDFLAATRTGARPAPVALSMDDISLMTY 195 Query: 187 SSGSTGAPKGTVHIHSDLIHTAELYARPILGIREGDVVFSAAKLFFAYGLGNGLIFPLAV 246 +SG+TG PKG + + + A G+ + + + A L+ G+ G+ P+ Sbjct: 196 TSGTTGLPKGAMLSYGNATFKTAASA-DCNGMTPHETLLAVAPLYHIAGMVMGVNLPVYT 254 Query: 247 GATAVLMAERPTPAAVFERLRRHQPDIFYGVPTLYASMLANPDCPKE--GELRLRACTSA 304 GATAVL+ R P V + L RH+ +Y + + +++ P LR TS Sbjct: 255 GATAVLLY-RFDPLGVAQALERHRVTWWYSIAPMNGALMQVPGARDMDWSALRRNPVTSF 313 Query: 305 GEALPEDVGRRWQARFGVDILD---GIGSTEMLHIFLSNRAGDVHYGTSGKPVPGYRLRL 361 G E + ++WQ +F + + G +E + + + +GT G+PVPG +R+ Sbjct: 314 GITFTEALAQQWQ-QFAPNCIAHEAAYGLSETHTVDTAMPVDAIRWGTQGQPVPGNTIRI 372 Query: 362 IDEDGAEITTAGVAGELQISGPSSAVMYWNNPEKTAATFMGEWTRSGDKYLVNDEGYYVY 421 +D D G GE+ I GP + YWN PE TA T W +GD ++ +GY + Sbjct: 373 VDPDTGAPLPTGEVGEITIHGPGNFKGYWNKPEATAKTLRDGWVYTGDMGKIDADGYLTF 432 Query: 422 AGRSDDMLKVSGIYVSPIEVESALIAHEAVLEAAVVGWEDEDHLIKPKAFIVLKPGYGAG 481 GR +M+KVSG V P EVE+ LI H AV +AAV+G D + +AFIV KPG Sbjct: 433 IGRFKEMIKVSGYSVFPEEVETLLIKHPAVAQAAVIGVPDAEKGEVARAFIVKKPGQDLD 492 Query: 482 EALRTDLKAHVKNLLAPYKYPRWIEFVDDLPKTATGKIQRFKLR 525 A L A + +APYK PR + F+D LP T GK+ R LR Sbjct: 493 AAA---LVAWCRENMAPYKAPREVRFIDALPATGAGKVLRRLLR 533 Lambda K H 0.319 0.138 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 739 Number of extensions: 46 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 527 Length of database: 536 Length adjustment: 35 Effective length of query: 492 Effective length of database: 501 Effective search space: 246492 Effective search space used: 246492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory