Align α-hydroxy-γ-carboxymuconate ε-semialdehyde dehydrogenase subunit (EC 1.1.1.312) (characterized)
to candidate Ac3H11_1189 4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase
Query= metacyc::MONOMER-8501 (319 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1189 Length = 317 Score = 545 bits (1405), Expect = e-160 Identities = 268/315 (85%), Positives = 289/315 (91%) Query: 4 TIKVALAGAGAFGIKHLDGIKNIDGVEVVSLVGRRFDQTKEVADKYGIKHVATDLAESLA 63 TIKVALAGAGAFGIKHLDGI+NIDGVEVVSL+ R +T EVADKYGIKHV TDLA+SLA Sbjct: 2 TIKVALAGAGAFGIKHLDGIQNIDGVEVVSLISRDLAKTLEVADKYGIKHVTTDLADSLA 61 Query: 64 LPEVDAVILCTPTQMHAEQAIACMKAGKHVQVEIPLADALKDAQEVAELQKQTGLVAMVG 123 + EVDAVILCTPTQMHA Q +AC++AGKHVQVEIPL D L D ++V LQKQTGLVAM G Sbjct: 62 IKEVDAVILCTPTQMHASQTLACLEAGKHVQVEIPLCDVLADGEKVIALQKQTGLVAMCG 121 Query: 124 HTRRFNPSHQWVHKKIEAGEFNIQQMDVQTYFFRRTNMNALGQARSWTDHLLWHHAAHTV 183 HTRRFNPSHQ+VH+KI AGEFNIQQMDVQTYFFRRTNMNALGQARSWTDHLLWHHAAHTV Sbjct: 122 HTRRFNPSHQYVHQKITAGEFNIQQMDVQTYFFRRTNMNALGQARSWTDHLLWHHAAHTV 181 Query: 184 DLFAYQAGSPIVKANAVQGPIHKDLGIAMDMSIQLKAANGAICTLSLSFNNDGPLGTFFR 243 DLFAYQAGSPIVKANA+QGPIHKDLGIAMDMSIQL+AANGAICTLSLSFNNDGPLGTFFR Sbjct: 182 DLFAYQAGSPIVKANAIQGPIHKDLGIAMDMSIQLQAANGAICTLSLSFNNDGPLGTFFR 241 Query: 244 YIGDTGTYVARYDDLFNGKEEKIDVSQVDVSMNGIELQDREFFAAIRERPRTNSSVQQVF 303 YIGD+ TY+ARYDDLFNGKEEKIDVS+VDVSMNGIELQDREFFAAI+E N+SV QV Sbjct: 242 YIGDSATYIARYDDLFNGKEEKIDVSKVDVSMNGIELQDREFFAAIKEGREPNASVAQVL 301 Query: 304 NCYKVLHDLEQQLNA 318 CY+VLH+LE QLNA Sbjct: 302 PCYQVLHNLELQLNA 316 Lambda K H 0.320 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 459 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 317 Length adjustment: 27 Effective length of query: 292 Effective length of database: 290 Effective search space: 84680 Effective search space used: 84680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory