Align subunit of 4-oxalomesaconate hydratase (EC 4.2.1.83) (characterized)
to candidate Ac3H11_1183 4-oxalomesaconate hydratase (EC 4.2.1.83)
Query= metacyc::MONOMER-3243 (342 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1183 Length = 344 Score = 612 bits (1578), Expect = e-180 Identities = 280/342 (81%), Positives = 311/342 (90%) Query: 1 MIIDVHGHYTTAPAALGAWRDLQIAGLKDPSKTPSVADLKISDDEIRETIETNQLRLMKE 60 +IID HGHYTTAP AL WR+ QIAG+KDPS P VADL ISDDE+RE+IETNQL+LMKE Sbjct: 3 LIIDCHGHYTTAPKALENWRNAQIAGIKDPSAMPKVADLHISDDELRESIETNQLKLMKE 62 Query: 61 RGSDLTIFSPRASFMAHHIGDFQTSSTWAAICNELCFRVSELFPDHFIPAAMLPQSPGVD 120 RGSD+T+FSPRASFMAHHIGDF SSTWAAICNELCFRVS LFPDHF+P AMLPQSPGVD Sbjct: 63 RGSDITLFSPRASFMAHHIGDFNVSSTWAAICNELCFRVSTLFPDHFVPVAMLPQSPGVD 122 Query: 121 PATCIPELVKCVEQYGNVGLNLNPDPSGGHWTSPPLSDKSWYPIYEKMVEYDIPAMIHVS 180 PATCIPEL KCV +YG VG+NLNPDPSGGHWTSPPL+DK WYPIYEKMVEYD+PAMIHVS Sbjct: 123 PATCIPELEKCVHEYGAVGINLNPDPSGGHWTSPPLTDKHWYPIYEKMVEYDLPAMIHVS 182 Query: 181 TSCNSCFHTTGSHYLNADTTAFMQCLTSDLFKDFPTLKFLIPHGGGAVPYHWGRFRGLAQ 240 TSCN+CFHTTG+HYLNADTTAFMQ + DLFKDFPTLKFLIPHGGGAVPYHWGRFRGLAQ Sbjct: 183 TSCNACFHTTGAHYLNADTTAFMQLIQGDLFKDFPTLKFLIPHGGGAVPYHWGRFRGLAQ 242 Query: 241 EMKKPLLEEHLLNNIYFDTCVYHQPGINLLTEVIPTKNILFASEMIGAVRGIDPQTGHYY 300 EMKKPLL++H++NN++FDTCVYHQPGI+LL VIP KN+LFASEMIGAVRGIDP TG+YY Sbjct: 243 EMKKPLLDDHVMNNVFFDTCVYHQPGIDLLNTVIPVKNVLFASEMIGAVRGIDPTTGNYY 302 Query: 301 DDTKRYIEATQNLTADEKHAVYEGNARRVFTRLDKALKAKGL 342 DDTKRYIEA+ L+A++KH +YE N RRVF+RLD LKAKGL Sbjct: 303 DDTKRYIEASTILSAEDKHQIYEANTRRVFSRLDTRLKAKGL 344 Lambda K H 0.320 0.137 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 547 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 342 Length of database: 344 Length adjustment: 29 Effective length of query: 313 Effective length of database: 315 Effective search space: 98595 Effective search space used: 98595 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory