Align 4-oxalomesaconate tautomerase; Gallate degradation protein D; EC 5.3.2.8 (characterized)
to candidate Ac3H11_4370 FIG00786362: hypothetical protein
Query= SwissProt::Q88JY0 (361 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4370 Length = 396 Score = 315 bits (808), Expect = 1e-90 Identities = 174/353 (49%), Positives = 227/353 (64%), Gaps = 5/353 (1%) Query: 4 TRIPCLLMRGGTSKGAYFLHDDLPAPGPLRDRVLLAVMGSPDARQIDGIGGADSLTSKVA 63 T +PC+LMRGGTS+G +FL D LP RDR L+A +GSP QIDG+GG +SLTSKVA Sbjct: 37 TNLPCVLMRGGTSRGPFFLADWLPQAPEARDRTLIAALGSPHELQIDGLGGGNSLTSKVA 96 Query: 64 IIRASQRDDADVDYLFAQVVVDEARVDYGQNCGNILAGVGPFALERGLVAASG-ASTPVR 122 I+ S + D DVDYLFAQV V EARVD NCGN+LAGVGPFA+E+GLVA SG +T VR Sbjct: 97 IVSRSTQPDCDVDYLFAQVSVQEARVDTRPNCGNMLAGVGPFAIEQGLVAPSGQGTTRVR 156 Query: 123 IFMENTGQIAVAQVPTADGQVEYAGDTRIDGVPGRAAALVVTFADVAGASCGALLPTGNS 182 ++ NT QV TA GQV Y GD RIDGV G AA +++ F D GA G + PTG Sbjct: 157 VYNVNTRSRIDVQVCTAGGQVHYDGDVRIDGVKGTAAPVLMNFLDAWGAVTGQIFPTGQR 216 Query: 183 RDCVEGVEVTCIDNGMPVVLLCAEDLGVTGYEPCETLEADSALKTRLEAIRLQLGPRMNL 242 D ++G++VTCID +VL+ A DLG+ G E L+ ++AL RLEA+RL+ G RM + Sbjct: 217 IDHIQGLDVTCIDAAQVMVLVRAADLGLRGDETPAELDTNTALLARLEALRLEAGQRMGM 276 Query: 243 GDVSQRNVPKMCLLSAPRNGGTVNTRSFIPHRCHASIGVFGAVSVATACLIEGSVAQGLA 302 GDV+ +PK ++S + G V +R F PH+CH S V GA+ VA A ++ G+VA Sbjct: 277 GDVTHSVLPKPVIVSPGTSPGCVVSRYFTPHQCHRSHAVTGAIGVAAASVLPGTVATDER 336 Query: 303 STSGGDRQRLAVEHPSGEFTVEISLEH--GVIK--GCGLVRTARLLFDGVVCI 351 S +R+ V+HP+G VE+ L G K LVRTAR + +G + + Sbjct: 337 SPPSAGLRRVEVQHPAGRIQVEVELSEVDGQFKLVQAALVRTARKILEGTLFV 389 Lambda K H 0.320 0.138 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 494 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 396 Length adjustment: 30 Effective length of query: 331 Effective length of database: 366 Effective search space: 121146 Effective search space used: 121146 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory