Align 4-hydroxy-2-oxovalerate aldolase; HOA; EC 4.1.3.39 (characterized)
to candidate Ac3H11_3372 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC 4.1.2.n4)
Query= SwissProt::O05151 (258 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3372 Length = 277 Score = 309 bits (792), Expect = 3e-89 Identities = 154/262 (58%), Positives = 194/262 (74%), Gaps = 10/262 (3%) Query: 1 MQSPINSFKKALAEGRTQIGFWLALGDAYSAEVCAGAGFDWLLIDGEHAPQDLRSVLAQL 60 M +P NSFK+ALA+G QIG WL L DAY+AE+ AG G+DWLL+DGEHAP DLRS+L QL Sbjct: 1 MHTPTNSFKQALAQGEAQIGLWLGLADAYTAEILAGTGYDWLLVDGEHAPNDLRSILHQL 60 Query: 61 QVIGAY--------RDCHAAVRVPSADTTVIKQYLDLGAQSLLVPMVDTADEAAAVVRAC 112 Q I + R HA RVP DT +IKQYLD+GAQ+LLVPMVDT ++A +VRA Sbjct: 61 QAIASASSALPPGARASHAVARVPVGDTALIKQYLDIGAQTLLVPMVDTPEQAQQLVRAT 120 Query: 113 RYPPGGIRGVGGA--RASRWGRYPRYLHEADEQVCVVVQAETALALSNLEAIAEVDGIDG 170 RY P G+RG+G A R+SRW YPRY+HEA++Q+C++VQAET A+++L+AIA G+DG Sbjct: 121 RYAPEGVRGMGSALARSSRWQAYPRYVHEANQQICLLVQAETVEAMAHLDAIAATPGVDG 180 Query: 171 VFIGTADLAASLGFPGNPAHPEVQDAILDALQRVRAAGKAPGVLTPVEDLAQKYLAHGAV 230 VFIG ADL+AS+G PGNP HP+VQ AI D + R+ AGKAPG+L E A+++LA GA+ Sbjct: 181 VFIGPADLSASMGHPGNPGHPDVQAAIHDGIARILRAGKAPGILATNEAQARQWLAAGAL 240 Query: 231 FVAVGIDTHLLAKQTSALAARF 252 FVAVG+DT LL L ARF Sbjct: 241 FVAVGVDTMLLTSAAQNLLARF 262 Lambda K H 0.320 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 277 Length adjustment: 25 Effective length of query: 233 Effective length of database: 252 Effective search space: 58716 Effective search space used: 58716 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory