Align 3-oxoadipate CoA-transferase (subunit 1/2) (EC 2.8.3.6) (characterized)
to candidate Ac3H11_3921 3-oxoadipate CoA-transferase subunit B (EC 2.8.3.6)
Query= BRENDA::P0A102 (213 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3921 Length = 201 Score = 272 bits (695), Expect = 4e-78 Identities = 134/197 (68%), Positives = 159/197 (80%), Gaps = 1/197 (0%) Query: 16 VAADIQEGAYVNLGIGAPTLVANYLGD-KEVFLHSENGLLGMGPSPAPGEEDDDLINAGK 74 VA DI +GAYVNLGIG PTLVAN++ + +EV L SENG+LGMGP+PA G ED DLINAGK Sbjct: 1 VAQDIHDGAYVNLGIGQPTLVANHIPEGREVILQSENGILGMGPAPAAGLEDYDLINAGK 60 Query: 75 QHVTLLTGGAFFHHADSFSMMRGGHLDIAVLGAFQVSVKGDLANWHTGAEGSIPAVGGAM 134 Q VTLL GGA+FHHADSF+MMRGGHLDI VLGA+QVS GDLANW TG G+IPAVGGAM Sbjct: 61 QPVTLLPGGAYFHHADSFAMMRGGHLDICVLGAYQVSATGDLANWSTGEPGAIPAVGGAM 120 Query: 135 DLATGARQVFVMMDHLTKTGESKLVPECTYPLTGIACVSRIYTDLAVLEVTPEGLKVVEI 194 DLA GA+Q +VMMD LTK G SK+V +CTYPLTG+ACV RIYTDL L TP GL++++ Sbjct: 121 DLAIGAKQTWVMMDLLTKQGASKIVTQCTYPLTGVACVKRIYTDLCTLACTPTGLQLIDT 180 Query: 195 CADIDFDELQKLSGVPL 211 + EL++L G+P+ Sbjct: 181 VPGLSQTELEQLVGLPI 197 Lambda K H 0.318 0.137 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 201 Length adjustment: 21 Effective length of query: 192 Effective length of database: 180 Effective search space: 34560 Effective search space used: 34560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory