Align 2-oxo-3-hexenedioate decarboxylase (EC 4.1.1.77) (characterized)
to candidate Ac3H11_1483 2-oxo-hepta-3-ene-1,7-dioic acid hydratase (EC 4.2.-.-)
Query= BRENDA::B0VXM8 (267 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1483 Length = 249 Score = 181 bits (460), Expect = 1e-50 Identities = 103/245 (42%), Positives = 144/245 (58%), Gaps = 8/245 (3%) Query: 24 KREVARITEEVPDLSAEEAYKIQEELIKIKTNSGHRIIGPKMGLTSQAKMAQMKVKEPIY 83 + ++ + + P+++ E+ Y IQ E ++++ G I G K+GLTS+A ++ EP Y Sbjct: 3 RTQLRHFSLQYPEMTIEDGYAIQREWVRLELAEGRTIKGRKIGLTSRAMQIASQITEPDY 62 Query: 84 GYLFDYMFVPSGGAIHMSELIHPKVEVEIAFILGEDLEGPHVTSTQVLSATKYVAPALEI 143 L D MF +GG I I P+VEVE+AFILG+ L+GP VT VLSAT YV PA+EI Sbjct: 63 APLMDDMFFDAGGDIPFERFIAPRVEVELAFILGKPLKGPGVTLFDVLSATDYVVPAIEI 122 Query: 144 IDSRYQDF------TFTLPDVIADNASSSRVVIGNTMTPIHSLKTDLDLIGAALYINGEL 197 IDSR + F + D I+D A+++ +V+G P+ L DL +GA L+ NG + Sbjct: 123 IDSRIEQFDRETRVMRKVFDTISDFAANAGIVLGG--RPVKPLDVDLRWVGALLHKNGVI 180 Query: 198 KACGAGAAVFNHPANSVAVLANMLARKGERLKAGDIILTGGITEAIQLSAGDTVIGQLDQ 257 + G AAV NHPAN VA LAN +A GE+L AGD++L G T AGD+ Sbjct: 181 EESGLAAAVLNHPANGVAWLANKIAPYGEQLNAGDVVLAGSFTRPTAAVAGDSFHADYGP 240 Query: 258 LGDVS 262 LG VS Sbjct: 241 LGSVS 245 Lambda K H 0.316 0.134 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 249 Length adjustment: 24 Effective length of query: 243 Effective length of database: 225 Effective search space: 54675 Effective search space used: 54675 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory