Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate Ac3H11_142 D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)
Query= BRENDA::F8A9V0 (325 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_142 Length = 313 Score = 136 bits (342), Expect = 8e-37 Identities = 83/244 (34%), Positives = 132/244 (54%), Gaps = 15/244 (6%) Query: 70 LLALRSAGYDHIDIETAKRLGIKVVNVPAYSPHAIADHTLAIMLALIRRLHRAHDKVRLG 129 +++ +G D ID AK GI+VV + A+A+ L ++LA + + + ++ G Sbjct: 69 VISKHGSGTDTIDKVAAKARGIEVVAAVGANAAAVAEQALTLLLACAKSVVQLDARMHAG 128 Query: 130 DFDLDGLMGFDLNGKVAGVIGLGKIGRLVATRLKAFGCKVLGYDPYIQ--PEIVENVDLD 187 +D +L G+ G++GLG IG A A G +V+G+DP+ + P+ V++V L+ Sbjct: 129 HWDKATHKSLELGGRTVGLVGLGAIGLRFAKMADALGMRVIGFDPFAKNLPDYVQSVGLE 188 Query: 188 TLITQADIISIHCPLTRENFHMFNEETFKRMKPGAILVNTARGGLIDTKALLEALKSGKL 247 T+ +AD +S+HCPLT EN M N T + K G I+VNTARGGLID ALL A++SG++ Sbjct: 189 TIWREADAVSLHCPLTDENRGMLNATTLAQCKRGVIVVNTARGGLIDEAALLAAVRSGQV 248 Query: 248 GGAALDVYEYERGLFFKNHQKEGIKDPYLAQLLGLANVVLTGHQAFLTREAVKNIEETTV 307 A LD + E H +G K + +L+ H +T +A N+ Sbjct: 249 MAAGLDSFAVEP--MTTGHPFQGEK-----------HFILSPHIGGVTSDAYVNMGVGAA 295 Query: 308 ENIL 311 +N+L Sbjct: 296 QNLL 299 Lambda K H 0.321 0.140 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 313 Length adjustment: 28 Effective length of query: 297 Effective length of database: 285 Effective search space: 84645 Effective search space used: 84645 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory