Align D-2-hydroxyglutarate--pyruvate transhydrogenase DLD2; D-2HG--pyruvate transhydrogenase DLD2; Actin-interacting protein 2; D-lactate dehydrogenase [cytochrome] 2, mitochondrial; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 (characterized)
to candidate Ac3H11_2934 D-2-hydroxyglutarate dehydrogenase
Query= SwissProt::P46681 (530 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2934 Length = 474 Score = 291 bits (744), Expect = 5e-83 Identities = 165/452 (36%), Positives = 256/452 (56%), Gaps = 18/452 (3%) Query: 86 DLSFYNEDWMRKYKGQSKLVLRPKSVEKVSLILNYCNDEKIAVVPQGGNTGLVGGSVPIF 145 DL+ + +DW R+ +G++ V+RP + ++V+ ++ C A+VPQGGNTGL GS P Sbjct: 22 DLTAWEQDWRRRVRGKALAVVRPANTQEVAAVVKACAAVGTAIVPQGGNTGLAVGSTPDD 81 Query: 146 D--ELILSLANLNKIRDFDPVSGILKCDAGVILENANNYVMEQNYMFPLDLGAKGSCHVG 203 +++LSL +N +R D + + +AG IL+N + +FPL L A+GSC +G Sbjct: 82 SGTQIVLSLTRMNAVRSVDTDNLTMTVEAGCILQNLQDVAQNAGVLFPLSLAAEGSCTIG 141 Query: 204 GVVATNAGGLRLLRYGSLHGSVLGLEVVMPNGQIVNSMHSMRKDNTGYDLKQLFIGSEGT 263 G + TNAGG +++RYG+ LGLEVV G++ + + +RKDNTGYDL+ LFIGSEGT Sbjct: 142 GNLGTNAGGTQVVRYGNARDLCLGLEVVTAQGEVWDGLKGLRKDNTGYDLRDLFIGSEGT 201 Query: 264 IGIITGVSILTVPKPKAFNVSYLSVESFEDVQKVFVRARQELSEILSAFEFMDAKSQVLA 323 +GIIT ++ P+P A ++ + S E + A ++L L+ FE M + L Sbjct: 202 LGIITAATMKLYPQPAANLTAWAAAPSMEHAVALLGLAHKQLGAGLTGFEVMGQFALSLV 261 Query: 324 KSQLKDAAFPL--EDEHPFYILIETSGS-NKDHDDSKLETFLENVMEEGIVTDGVVAQDE 380 + P +D P+ +L+E S S +++H ++ E+ LE E G VTD VVA++ Sbjct: 262 GKHMPQLRVPFLGDDNAPWCVLLENSDSESEEHARARFESLLETAFEMGCVTDAVVAENL 321 Query: 381 TELQNLWKWREMIPEASQANGGVYKYDVSLPLKDLYSLVEATNARLSEAELVGDSPKPVV 440 T+ LW RE IP A G K+D+S+ + + + V T+A L + E+ P V Sbjct: 322 TQAHQLWHIRESIPLAQAEEGLNIKHDISIQISRIPAFVAHTDAVL-QREI------PGV 374 Query: 441 GAIGYGHVGDGNLHLNVAV------REYNKNIEKTLEPFVYEFVSSKHGSVSAEHGLGFQ 494 + +GH+GDGNLH NV + + + E + VYE V+ GS SAEHG+G Sbjct: 375 RLVNFGHLGDGNLHYNVQAPAAGDPKAFLREQEARVNHLVYEAVAEFGGSFSAEHGIGEL 434 Query: 495 KKNYIGYSKSPEEVKMMKDLKVHYDPNGILNP 526 K + + +SP + MM+ +K DP G++NP Sbjct: 435 KADKLAKYQSPVALGMMRAIKQALDPQGVMNP 466 Lambda K H 0.316 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 509 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 530 Length of database: 474 Length adjustment: 34 Effective length of query: 496 Effective length of database: 440 Effective search space: 218240 Effective search space used: 218240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory