Align D-lactate transporter, ATP-binding component (characterized)
to candidate Ac3H11_104 Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)
Query= reanno::Phaeo:GFF1248 (251 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_104 Length = 249 Score = 186 bits (472), Expect = 4e-52 Identities = 96/249 (38%), Positives = 149/249 (59%), Gaps = 7/249 (2%) Query: 3 ILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMF 62 IL VK + +FG L+A+ DV+ + + A+IGPNGAGKS+L N + G + P +G+V F Sbjct: 4 ILSVKGISVQFGALKAVQDVSFEAQPGKITAVIGPNGAGKSSLFNLISGAIRPSSGAVRF 63 Query: 63 DGKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPC--FAKRDGAFEMNAISAVS 120 DG+ V GRAP+++ + G+SR FQ +F +L V EN+ + + G F A S + Sbjct: 64 DGEDVTGRAPHQLLRYGLSRSFQITNLFFELPVRENLRLAAQFLEQGRGLFRPLARSQTA 123 Query: 121 GQRDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMA 180 R + +LE+ ++ +K A +S G++RRLEI + L+ PR+LLLDEPT GM+ Sbjct: 124 AAR-----VDELLEQFDLRNKADELAGYLSHGEQRRLEIAVSLASRPRMLLLDEPTQGMS 178 Query: 181 RADTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGNP 240 DT T L++ + ++I ++EHD+ +V L+D + V+ QG L E P ++ NP Sbjct: 179 HGDTRETESLIRGLSHNHGLSILLVEHDVDLVMQLSDFVVVMHQGQKLAEGTPAQVRANP 238 Query: 241 KVREAYLGE 249 V+ AY GE Sbjct: 239 AVQAAYFGE 247 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 249 Length adjustment: 24 Effective length of query: 227 Effective length of database: 225 Effective search space: 51075 Effective search space used: 51075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory