GapMind for catabolism of small carbon sources

 

Aligments for a candidate for glcD in Acidovorax sp. GW101-3H11

Align D-lactate oxidase, FAD-linked subunit (EC 1.1.3.15) (characterized)
to candidate Ac3H11_4483 Glycolate dehydrogenase (EC 1.1.99.14), subunit GlcD

Query= reanno::Cup4G11:RR42_RS17300
         (497 letters)



>lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4483 Glycolate
           dehydrogenase (EC 1.1.99.14), subunit GlcD
          Length = 504

 Score =  715 bits (1845), Expect = 0.0
 Identities = 357/484 (73%), Positives = 404/484 (83%)

Query: 14  ARRSALLAGLAKILPDAALLWKPEDTVPYECDGLAAYRQVPMAVALPDNEDQVCAILRLC 73
           AR++ ++  L + +P  ALLW  EDT PYECDGL AYRQ P+ V LP+  D+V A+LR C
Sbjct: 21  ARQAEVVQALGQAVPAHALLWHSEDTTPYECDGLTAYRQRPLVVCLPETYDEVQAVLRAC 80

Query: 74  HSLQVPVVPRGAGTSLSGGAMPIATGLVLSLAKFKRIVSVDVRSRTAVVQPGVRNLAISE 133
           H LQVPVV RGAGT LSGGAMP A G+ LSLAKF RI+++   SRTAVVQ GVRNLAISE
Sbjct: 81  HRLQVPVVARGAGTGLSGGAMPHAMGVTLSLAKFNRILNLSPESRTAVVQSGVRNLAISE 140

Query: 134 AAAQYNLYYAPDPSSQIACTIGGNVSENSGGVHCLKYGLTVHNVLRVRAVTMEGDVVEFG 193
           AAA +NLYYAPDPSSQIACTIGGNV+ENSGGVHCLKYGLTVHNVL+V+  T+EG+ VEFG
Sbjct: 141 AAAPHNLYYAPDPSSQIACTIGGNVAENSGGVHCLKYGLTVHNVLKVKGFTVEGEPVEFG 200

Query: 194 SEAPDAPGLDLLAAVIGSEGMLAVVTEVSVKLIPKPQLAQVIMASFDDVAKGGNAVADVI 253
           SEA D+PG DLLAAVIGSEGMLAV+TEV+V+LIPKPQLA+ IMASFDDV K G+AVA VI
Sbjct: 201 SEALDSPGYDLLAAVIGSEGMLAVITEVTVRLIPKPQLARCIMASFDDVRKAGDAVAAVI 260

Query: 254 GAGIIPAGLEMMDKPATAAVEEFVRAGYDLDAAAILLCESDGTPEEVAEEVERMSEVLRA 313
            AGIIPAGLEMMDKP TAAVE+FV AGYDL A AILLCESDGTPEEV EE+ RMSEVLRA
Sbjct: 261 AAGIIPAGLEMMDKPMTAAVEDFVHAGYDLTAEAILLCESDGTPEEVEEEIGRMSEVLRA 320

Query: 314 SGASRIQVSQSEPERLRFWSGRKNAFPAAGRISPDYYCMDGTIPRKHIGTLLKRIEEMER 373
           +GA+ I VS+ E ERLRFWSGRKNAFPA+GRISPDY CMD TIPRK +  +L  I+EME+
Sbjct: 321 AGATAISVSRDEAERLRFWSGRKNAFPASGRISPDYMCMDSTIPRKRLADILLAIQEMEK 380

Query: 374 KYGLRCMNVFHAGDGNMHPLILFDGADQDEWHRAELFGSDILESCVELGGTVTGEHGVGV 433
           KY LRC NVFHAGDGN+HPLILFD  D D+ HR ELFG+DILE+ V +GGTVTGEHGVGV
Sbjct: 381 KYQLRCANVFHAGDGNLHPLILFDANDADQLHRCELFGADILETSVAMGGTVTGEHGVGV 440

Query: 434 EKLNSMCVQFSAQERDLFFGVKAAFDPARLLNPDKAIPTLARCAEYGRMHVKRGLLPHPD 493
           EKLNSMCVQF+A+E    FG+K AFDPA LLNP K IPTL RCAEYG+M V+ G + HP 
Sbjct: 441 EKLNSMCVQFTAEENAQMFGLKHAFDPAGLLNPGKVIPTLNRCAEYGKMLVRGGQIRHPA 500

Query: 494 LPRF 497
           LPRF
Sbjct: 501 LPRF 504


Lambda     K      H
   0.319    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 749
Number of extensions: 14
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 497
Length of database: 504
Length adjustment: 34
Effective length of query: 463
Effective length of database: 470
Effective search space:   217610
Effective search space used:   217610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory