GapMind for catabolism of small carbon sources

 

Aligments for a candidate for glcF in Acidovorax sp. GW101-3H11

Align D-lactate oxidase, iron-sulfur subunit (EC 1.1.3.15) (characterized)
to candidate Ac3H11_3398 Glycolate dehydrogenase (EC 1.1.99.14), iron-sulfur subunit GlcF

Query= reanno::Cup4G11:RR42_RS17315
         (421 letters)



>lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3398 Glycolate
           dehydrogenase (EC 1.1.99.14), iron-sulfur subunit GlcF
          Length = 417

 Score =  524 bits (1350), Expect = e-153
 Identities = 267/426 (62%), Positives = 313/426 (73%), Gaps = 18/426 (4%)

Query: 1   MQTTLAEFLRDTPDGEEAKSIVGKCVHCGFCTATCPTYQLLGDELDGPRGRIYLMKQVLE 60
           MQT L+   R   DG EA+SI+ KCVHCGFCTATCPTYQLLGDELDGPRGRIYL+KQVLE
Sbjct: 1   MQTQLSPEYRARADGLEAESILRKCVHCGFCTATCPTYQLLGDELDGPRGRIYLIKQVLE 60

Query: 61  GQPVTQSTRLHLDRCLTCRNCESTCPSGVKYGRLVDIGRKVVDDRLEAQGIQRPARERFA 120
           G+  T+ T++HLDRCLTCRNCESTCPSGV+YG LVDIGRK+VD++     + RP  E+  
Sbjct: 61  GETPTRKTQMHLDRCLTCRNCESTCPSGVQYGHLVDIGRKIVDEK-----VPRPVGEKAL 115

Query: 121 RWALRETMTRPALFGTAMRMGQRVRPLLPQALRNKVPQAVDAGAWPRTTHARKMLLLDGC 180
           RWAL+E +  P LF  AM+ GQ VR LLP+AL+ KVP   DAGAWP   HARK+LLL GC
Sbjct: 116 RWALKEGLPSP-LFAPAMKAGQLVRGLLPEALKAKVPAPQDAGAWPTREHARKVLLLAGC 174

Query: 181 VQPSMSPNINAATARVFDRLGVQLVMAREAGCCGAVRYHTGDHDGGLDNMRRNIDAWWPA 240
           VQ +M PNIN ATARV D +G+Q V+A +AGCCGAV++H  D  GG+  MR NIDAWWP 
Sbjct: 175 VQLAMMPNINTATARVLDAVGIQTVIAPKAGCCGAVKFHLNDQAGGMAEMRANIDAWWPL 234

Query: 241 VQA-GAEAIVMTASGCGVMVKEYGHLLRNDAHYADRARQISALTKDLSELLPNFADALQD 299
           V+A G EAIVM ASGCGV VKEYGH+L++DA YA +A +ISALT+DLSELLP     L D
Sbjct: 235 VEAGGVEAIVMNASGCGVTVKEYGHILKDDAQYAAKAERISALTRDLSELLPAMLPELAD 294

Query: 300 AAAEAGSSKGTNGTDGQRVAYHPPCTLQHGQQIRGKVEALLTGLGVDVKLCA-DSHLCCG 358
                   +G         AYHPPCTLQHGQ++RG VEA L  LG  +     D+HLCCG
Sbjct: 295 ------KLQGRVNQPDTMYAYHPPCTLQHGQKLRGGVEAHLNQLGFQLSTARNDAHLCCG 348

Query: 359 SAGTYSVLQPALSYRLRDEKLANLQAL----KPEAIVSANIGCITHLQSGTGTPVMHWIE 414
           SAGTYSVL P LSY+LRD KL  L        P+ I+SANIGCITHLQSGTGTPV HW+E
Sbjct: 349 SAGTYSVLNPDLSYQLRDRKLGVLAEAFGEQPPDMILSANIGCITHLQSGTGTPVRHWVE 408

Query: 415 LVDRML 420
           ++D  L
Sbjct: 409 VLDEAL 414


Lambda     K      H
   0.321    0.135    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 640
Number of extensions: 25
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 421
Length of database: 417
Length adjustment: 32
Effective length of query: 389
Effective length of database: 385
Effective search space:   149765
Effective search space used:   149765
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory