Align D-Serine ammonia-lyase (EC 4.3.1.18) (characterized)
to candidate Ac3H11_4836 Threonine dehydratase (EC 4.3.1.19)
Query= BRENDA::Q54HH2 (324 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4836 Length = 399 Score = 202 bits (514), Expect = 1e-56 Identities = 108/318 (33%), Positives = 191/318 (60%), Gaps = 7/318 (2%) Query: 7 VTLKDIKEAHKRIEKYIHKTPVLTNSTINELAGKELYFKCENLQKTGSFKMRGACNAIFS 66 +TL+DI++A R++ + TP + + T++++ G +++ K ENLQ T SFK RGACN + Sbjct: 2 LTLQDIRDAATRLQGQVLDTPCVESKTLSQIVGAQVFLKFENLQFTASFKERGACNRLTL 61 Query: 67 LDEEELSKGVVTHSSGNHGQALSYASKVRCVKCYVVVPEDAPSVKLNAICGYGATVTKCK 126 L E+E ++GVV S+GNH Q ++Y ++ ++ +V+P P+VK+ G+GA V Sbjct: 62 LSEDERARGVVAMSAGNHAQGVAYHAQRLGLRAVIVMPRFTPAVKVERTRGFGAEVVLHG 121 Query: 127 ATLEARESNTKQLIEQHSCKLIHPFDNLQVIAGQGTASLELMEQVENLDAIITPVGGGGL 186 TLE + L + +HP+D+ V AGQGT LE+++ V +LD ++ VGGGGL Sbjct: 122 DTLEEARQHAYALADAQRLTFVHPYDDEGVAAGQGTLGLEMLQAVPDLDTLVIAVGGGGL 181 Query: 187 LSGTCITAKSLNPNIKVFAAEPLGADDTYRSLLSGEIQKHTPGKPNTIADGL-LTTVGSL 245 +SG AK++ P I+V + + ++++ H P +TIA+G+ + T G + Sbjct: 182 ISGVATAAKAIKPGIEVVGVQ----TTRFPAMVNAVKGTHHPQGTSTIAEGIAVGTPGKI 237 Query: 246 TFPIIKENCDGVILVTEDEIKYAMKLVWERMKIIIEPSSATTLAAILKQEFKDKKDIKKV 305 T I+K D ++LV E +I+ A+ ++ E K ++E + A LAA+++ + ++ K+V Sbjct: 238 TQEIVKRLVDDLVLVDEGDIEQAVLMLLEIEKTLVEGAGAAGLAALVR--YPERFQGKRV 295 Query: 306 GIIISGGNVDLSSISKIL 323 G+++ GGN+D ++ I+ Sbjct: 296 GLVLCGGNIDPLLLAAII 313 Lambda K H 0.315 0.132 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 399 Length adjustment: 29 Effective length of query: 295 Effective length of database: 370 Effective search space: 109150 Effective search space used: 109150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory