Align actP-like component of L-lactate and L-malate uptake system (characterized)
to candidate Ac3H11_204 Acetate permease ActP (cation/acetate symporter)
Query= reanno::PV4:5209923 (572 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_204 Length = 699 Score = 187 bits (474), Expect = 2e-51 Identities = 108/298 (36%), Positives = 168/298 (56%), Gaps = 16/298 (5%) Query: 259 LMFGTAGLPHVIVRFFTVPKVKDARVSAGWALVFIAIMYTTIPALAAFSRVNMIETINGP 318 LM GTAGLPH++ RF+T P V AR S GW+L FIA++Y + PALA + +++ + Sbjct: 403 LMVGTAGLPHLLTRFYTSPSVSAARASVGWSLFFIALLYLSAPALAVLVKFEVMQNL--- 459 Query: 319 ESTGVAYETAPDWIKNWEK--TGLIKWDDKNNDGKIYYAKGETNEMKIDRDIMVLATPEI 376 G ++E P W+ W + + L+ +D N DG I + E+++ D+++LATPE+ Sbjct: 460 --VGSSFEALPTWMAQWSRVDSSLLSLEDVNGDGLIQFG-----EIRLGADLIMLATPEL 512 Query: 377 ANLPAWVIALVAAGGLAAALSTSAGLLLVISTSVSHDLLKKNFMPDISDKQELLYARIAA 436 LP V LVAAGGLAAALST+ GLLL IS ++ DL ++ S +Q ++ ++ A Sbjct: 513 GGLPYVVSGLVAAGGLAAALSTADGLLLTISNALVRDLYFQDSQRKASPEQRVILSKFAL 572 Query: 437 ALGIVMAGYFGINPPGFVAAVVAIAFGLAASSLFPAIIMGIFSRTMNKEGAIAGMVIGL- 495 + A + P + +V+ +F LAAS+ PA+++GIF R ++GA+AGM+ GL Sbjct: 573 LAVALSAAFVAALKPSEILPMVSASFSLAASAFVPAMVLGIFWRGTTRQGAVAGMLTGLG 632 Query: 496 ---LFSASYIIYFKFVNPGDNNASNWLFGISPEGIGMLGMIINFAVAFIVSKVTAAVP 550 + S++ + V P A FGI P G+ G+ V ++S +T P Sbjct: 633 IAVYYMLSHVPAVQGVLPRWLLADGLWFGIQPISAGVFGVPCGLLVTVVLSWMTRPAP 690 Score = 184 bits (467), Expect = 1e-50 Identities = 88/208 (42%), Positives = 134/208 (64%), Gaps = 7/208 (3%) Query: 14 TFALYIGIAIWSRAGSTKEFYVAGGGVHPVMNGMATAADWMSAASFISLAGIVSFVGYDG 73 T +Y GI ++ R +++YVAG + P+ NGMATAADWMSAASFISL+G + G+ G Sbjct: 58 TVMVYAGIGVYGRTTDPEDYYVAGRRIPPMYNGMATAADWMSAASFISLSGALYLQGFSG 117 Query: 74 S-------VYLMGWTGGYVLLALCMAPYLRKFGKFTVPDFIGDRYYSQAARTVAVVCAIF 126 + YL+GWTGG+ L+A+ +AP+LR G +T+PDF R+ + R +A + A+ Sbjct: 118 TPGQAGGLAYLLGWTGGFCLVAMLIAPHLRAMGLYTIPDFFHVRFGGRWPRVIAALAAVL 177 Query: 127 ICFTYIAGQMRGVGVVFSRFLEVEVDTGVYIGMAVVFFYAVLGGMKGITYTQVAQYCVLI 186 FTY+ Q+ GVG++ SR V+ + G+ +G+ V + LGGM+ IT+TQVAQY VL+ Sbjct: 178 CSFTYVVAQIYGVGLIASRLTGVQFEIGIMLGLGGVLLCSFLGGMRAITWTQVAQYVVLL 237 Query: 187 FAFMVPAIFISVMMTGHILPQLGFGAEL 214 AFM+P +++ G+ L L +G ++ Sbjct: 238 LAFMIPVSWLAYKQLGNPLAPLVYGEQI 265 Lambda K H 0.326 0.140 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1043 Number of extensions: 48 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 572 Length of database: 699 Length adjustment: 38 Effective length of query: 534 Effective length of database: 661 Effective search space: 352974 Effective search space used: 352974 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory