Align isobutanoate/2-methylbutanoate--CoA ligase (EC 6.2.1.1) (characterized)
to candidate Ac3H11_663 Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)
Query= metacyc::MONOMER-20125 (556 letters) >lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_663 Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3) Length = 559 Score = 171 bits (432), Expect = 9e-47 Identities = 160/573 (27%), Positives = 242/573 (42%), Gaps = 69/573 (12%) Query: 6 PRPASSSPLTPL-GFLERAATVYGDCTSVVYDAVSYTWSQTHRRCLCLASSIASLGIENG 64 P +S T L ++ A Y D + + T+ QT A+ + SLG+ G Sbjct: 15 PADIDTSQYTSLVALMDEAFKKYADRVAYSFMGKEVTYGQTDSLSSAFAAYLQSLGLVKG 74 Query: 65 HVVSVLAPNVPQMYELHFAVPMAGAILNAVNLRLDARTISILLHHSESKLIFVDHLSRDL 124 V+++ PNVPQ AV AG ++ VN R + L S +K I + Sbjct: 75 DRVAIMMPNVPQYPVAVAAVLRAGFVVVNVNPLYTPRELEHQLKDSGAKAIVIIENFAAT 134 Query: 125 ILEAIALFPKQAPVPRLVFMADESESG------------NSSELGKEF----FCSYKDLI 168 + + IA PV +V A + G N ++ + + + Sbjct: 135 LEQCIA----HTPVKHVVLCAMGDQLGLLKGALVNYVVRNVKKMVPAYNLPGAVRFNQAV 190 Query: 169 DRGD------PDFKWVMPKSEWDPMILNYTSGTTSSPKGVVHCHRGIFIMTVDSLIDWGV 222 +G PD K D +L YT GTT KG V HR I + S W Sbjct: 191 AQGTRSTLKKPDIK------PDDIALLQYTGGTTGVSKGAVLLHRNILANVLQSEA-WNS 243 Query: 223 P--------KQPVYLWTLPMFHANGWSYPW--GMAAVGGTNICLRKFDSEIIYDMIKRHG 272 P +QP + LP++H ++ M G T + D + + +H Sbjct: 244 PVMSKVPAGEQPTAVCALPLYHIFAFTVNMMLSMRTGGKTILIPNPRDLPAVLKELSKHT 303 Query: 273 VTHMCGAPVVLNMLSNAPGSEPLK-TTVQIMTAGAPPPSAVLFRT--ESLGFAVSHGYGL 329 + N L+N P + +++ G + + E G + GYGL Sbjct: 304 FHSFPAVNTLFNGLANHPDFNTVNWKNLKVSVGGGMAVQGAVAKLWLEKTGCPICEGYGL 363 Query: 330 TETAGLVVSCAWKKEWNHLPATERARLKSRQGVGTVMQTKIDVVDPVTGAAVKRDGSTLG 389 +ET+ SC N + ATE GT M+ D +T G Sbjct: 364 SETSPST-SC------NPVTATEYTGTIGVPIPGTYMKLIDDEGREITTLGEP------G 410 Query: 390 EVVLRGGSVMLGYLKDPEGTAKSMTADGWFYTGDVGVMHPDGYLEIKDRSKDVIISGGEN 449 E+ ++G VM GY + P+ TAK MT DG+F +GD+G+M G+ +I DR KD+++ G N Sbjct: 411 EIAIKGPQVMAGYWQRPDETAKVMTDDGYFKSGDIGIMDARGFFKIVDRKKDMVLVSGFN 470 Query: 450 LSSVEVESILYSHPDILEAAVVARPDEFWGETPCAFVSLKKGLTKKP---TEKEIVEYCR 506 + EVE ++ S P +LE AVV PDE GE ++K + KK TE ++ E+CR Sbjct: 471 VYPNEVEEVVASCPGVLECAVVGVPDEKTGE------AVKLVIVKKDPALTEAQVKEFCR 524 Query: 507 SKLPRYMVPKTVVFKEELPKTSTGKVQKFILRD 539 +L Y PK + F+ ELPKT GK+ + LRD Sbjct: 525 RELTGYKQPKVIEFRTELPKTPVGKILRRELRD 557 Lambda K H 0.319 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 766 Number of extensions: 41 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 556 Length of database: 559 Length adjustment: 36 Effective length of query: 520 Effective length of database: 523 Effective search space: 271960 Effective search space used: 271960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory