Align C4-dicarboxylate-binding periplasmic protein DctP (characterized)
to candidate Ac3H11_2073 TRAP-type C4-dicarboxylate transport system, periplasmic component
Query= SwissProt::P37735 (333 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2073 Length = 328 Score = 168 bits (426), Expect = 2e-46 Identities = 107/320 (33%), Positives = 168/320 (52%), Gaps = 11/320 (3%) Query: 10 LVGATALSLALSVPALAEPIVIKFSHVVAPDTPKGKGAAKFEELAEKYTNGAVDVEVYPN 69 L+ A AL++AL A A+ + + H AP P+ + A KF E + T G ++V+V P+ Sbjct: 10 LLAAAALAVALPGLAQAQAMKLTLGHGAAPGNPRHEAAVKFAETLKAKTAGRIEVQVAPS 69 Query: 70 SQLYKDKEELEALQLGAVQMLAPSLAKFGPLGVQDFEVFDLPYIFKDYEALHKVTQGEAG 129 +QL D + A++ GA+ M A S + V ++ + +P++F K+ G G Sbjct: 70 AQLGDDAAMVTAVRTGALDMTANSQGAVS-VAVPEYAAYGMPFMFSTPAQAFKLLDGPLG 128 Query: 130 KMLLSKLEAKGITGLAFWDNGFKIMS-ANTPLTMPDDFLGLKMRIQSSKVLEAEMNALGA 188 + L K KG+ L +WDNG + M+ + P+T +D GLKMR VL M ALGA Sbjct: 129 QELAQKSADKGMVVLGYWDNGIRHMTNSKRPITKVEDMKGLKMRTPPDAVLVDIMQALGA 188 Query: 189 VPQVMAFSEVYQALQTGVVDGTENPPSNMFTQKMNEVQKHATVSNHGYLGYAVIVNKQFW 248 Q + F+E+Y ALQ GVVDG ENP N+ K+ EVQKH +++H + +++K+ W Sbjct: 189 EAQQIKFAELYVALQQGVVDGQENPLVNIHASKLYEVQKHLALTSHMFQMTPFLMSKRTW 248 Query: 249 DGLPADVRTGLEKAMAESTDYANGIAKEENEKALQAMKDAGT-------TEFHELTAEER 301 D L R + +A AE+T +++E ++K L +K G F + TA Sbjct: 249 DRLSDADRKAVTEAAAEATALQRKMSQEADDKLLDDLKAKGVQVTTVDKAAFAKATAAVD 308 Query: 302 AAWEEVLTPVHDEMAERIGA 321 A W + TP+ + + I A Sbjct: 309 AKW--LTTPIGPYLKKVIAA 326 Lambda K H 0.314 0.130 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 328 Length adjustment: 28 Effective length of query: 305 Effective length of database: 300 Effective search space: 91500 Effective search space used: 91500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory