Align N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) (characterized)
to candidate Ac3H11_2115 Phosphoenolpyruvate-protein phosphotransferase of PTS system (EC 2.7.3.9)
Query= reanno::pseudo5_N2C3_1:AO356_17540 (837 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2115 Length = 585 Score = 270 bits (691), Expect = 1e-76 Identities = 189/572 (33%), Positives = 282/572 (49%), Gaps = 33/572 (5%) Query: 278 LHGVCAAPGLVTGPLVRLSGIQLPEDIGGHAIE-EQRQRLSDALAQVRGEIHLTLEHARA 336 +HG+ A G+ G V ++ ++ D+ + +E Q + + + Q R + L+ + Sbjct: 5 VHGLAVARGIAIGRAVLVASSRV--DVAHYFVEPSQVEGEIERVRQGRNAVVEELQRLQT 62 Query: 337 RQHRDEE----AIFSAHLALLEDPVLLDAADLFI-EQGSAAPHAWSRSIDTQCQVLQQLG 391 D A+ HL LL+D L +I E+ A A + ++ + ++ Sbjct: 63 DMPTDAPHELTALLDVHLMLLQDEALTGGVKHWITERLYNAEWALTTQLEVIARQFDEME 122 Query: 392 STLLAERANDLRDLRQRVLRVLLGEAWQFDVAAGA-------------------IVAAQE 432 L ER DL + +R+LR + G A A + ++ A + Sbjct: 123 DEYLRERKADLEQVVERILRHMKGVASPVAPPASSPRRKTQQDLLLDDTVDVPLVLVAHD 182 Query: 433 LTPSDLLQLSAQGVAGVCMVEGGATSHVAILARGKGLPCLVALGDELLAQEQGQAVVLDA 492 L+P+D+LQ AG GG TSH AI+AR +P +V Q V++D Sbjct: 183 LSPADMLQFKQSVFAGFVTDVGGKTSHTAIVARSMDIPAVVGARAASQLVRQDDWVIIDG 242 Query: 493 DGGRLELTPTVERLAQVRQAQTRRTALRAQQQSLAHTPARTVDGVEVEVAANVASSAEAG 552 D G + + P+ LA+ Q + R + L HTPA T+DG ++E+ AN+ +A Sbjct: 243 DAGVVIVDPSPIILAEYGFRQRQVELERERLARLRHTPAITIDGHKIELLANIEQPGDAA 302 Query: 553 ESLANGADGVGLLRTEFLFVDRH-TAPDEEEQRQAYQAVLEAMGDKPVIIRTIDVGGDKQ 611 ++ GA GVGL R+EFLF+ + P E+EQ +AY ++ M PV IRTIDVG DK Sbjct: 303 AAVRAGAVGVGLFRSEFLFMGKSGNLPGEDEQYRAYCEAIDGMQGLPVTIRTIDVGADKP 362 Query: 612 LDYLPLPSE-ANPVLGLRGIRLAQVRPDLLDQQLRALLQTRPLDRCRILLPMVTEVDELL 670 LD NP LGLR IR + P + QLRA+L+ + +L PM+ E+ Sbjct: 363 LDNKAHKDNYLNPALGLRAIRWSLADPAMFRTQLRAVLRAAAHGKVNLLFPMLAHTHEIQ 422 Query: 671 HIRKRLDALGSELGLSERP----QLGVMVEVPAAALLAEQLAEHADFLSIGTNDLSQYTL 726 ++D +EL P QLG M+EVPAAAL+ ++ DFLSIGTNDL QYTL Sbjct: 423 QTLAQVDLARAELDARGEPYGPVQLGAMIEVPAAALMVRTFLKYFDFLSIGTNDLIQYTL 482 Query: 727 AMDRDHAGLAARVDALHPALLRLIAQTCAGAAKHGRWVGVCGALASDPLATPVLIGLGVR 786 A+DR +A D LHPA+LRL+ A + G+ V VCG A D T +L+GLG+R Sbjct: 483 AIDRADEAVAHLYDPLHPAVLRLVGDVIAEGERQGKSVCVCGETAGDVTMTRLLLGLGLR 542 Query: 787 ELSVSPPQIGEIKDRVRHLDAAQCARLSNELL 818 S+ P QI IK V D + A + +++ Sbjct: 543 SFSMHPAQILAIKQEVLRADTRKLAPWAQQVI 574 Lambda K H 0.319 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 978 Number of extensions: 43 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 837 Length of database: 585 Length adjustment: 39 Effective length of query: 798 Effective length of database: 546 Effective search space: 435708 Effective search space used: 435708 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory