Align putative transporter, required for glycine and L-alanine utilization (characterized)
to candidate Ac3H11_3909 Putative membrane protein
Query= reanno::ANA3:7023996 (213 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3909 Length = 214 Score = 134 bits (336), Expect = 2e-36 Identities = 74/198 (37%), Positives = 111/198 (56%), Gaps = 5/198 (2%) Query: 9 LLWLIGILAEAMTGALAAGRKQMDLFGVVIIGCATAIGGGTLRDMLLGNYPLIWVENVHY 68 LL + +A A++G +AA RK++D+ GV ++ A GGGTLRD+LL P WV + + Sbjct: 16 LLEVAATMAFALSGVIAAARKRLDVVGVCVVAFVAAFGGGTLRDLLLDQRPFFWVRHTGF 75 Query: 69 ---LLAIAFASLLTVAIAPVMRYLSKLFLAIDALGLAVFSIVGAQKTLMLGFSPTIAVVM 125 +LA+ ++L + + + L DA+GL +F+ VG +G P I+V+M Sbjct: 76 VWGILALCVGAMLFMRQRH-FKPTERAMLLPDAIGLGLFAAVGVDIATAIGMPPIISVMM 134 Query: 126 GLVTGVFGGVIRDILCNQVPLIFKKELYAVISLFTAG-LYITLNAYQLAEWINLVVCLTL 184 G+ TGVFGGV+RD+LCN+VP F + F G + L Q +W LVVC+ L Sbjct: 135 GVTTGVFGGVLRDVLCNEVPQAFSDHRPYALCAFAGGWADVALRHLQAPDWAPLVVCVLL 194 Query: 185 GFSLRMLALRYHWSMPTF 202 LR LAL +W +P + Sbjct: 195 TAGLRGLALWRNWELPAW 212 Lambda K H 0.330 0.143 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 214 Length adjustment: 22 Effective length of query: 191 Effective length of database: 192 Effective search space: 36672 Effective search space used: 36672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory