Align glycolaldehyde oxidoreductase small subunit (characterized)
to candidate Ac3H11_2238 Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16)
Query= metacyc::MONOMER-18073 (163 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2238 Length = 153 Score = 105 bits (263), Expect = 3e-28 Identities = 53/128 (41%), Positives = 75/128 (58%), Gaps = 1/128 (0%) Query: 35 LREELGLTGTKIGCDTTTCGACTVLLNGKSVKSCTLFAVQADGAEITTIEGLSVDSKL-H 93 LR+ LG+TGTK GC CGACTV LNG ++SC A G +ITTIE ++ K+ Sbjct: 25 LRDTLGMTGTKFGCGQALCGACTVHLNGAPIRSCITPISAAAGQKITTIEAVTASDKVGK 84 Query: 94 PIQEAFKENFALQCGFCTPGMIMQAYFLLKENPNPSEEEVRDGLHGNICRCTGYQNIVKA 153 + A+ ++ QCG+C G IM A LLK P++ ++ + GN+CRC Y I A Sbjct: 85 AVHAAWVKHDVAQCGYCQSGQIMSATALLKGKKKPTDADIDAAMAGNVCRCGTYVRIRAA 144 Query: 154 VLDASRRL 161 + DA++ L Sbjct: 145 IHDAAKAL 152 Lambda K H 0.322 0.138 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 86 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 153 Length adjustment: 17 Effective length of query: 146 Effective length of database: 136 Effective search space: 19856 Effective search space used: 19856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory