Align Periplasmic binding protein/LacI transcriptional regulator (characterized, see rationale)
to candidate Ac3H11_611 Putative sugar ABC transport system, periplasmic binding protein YtfQ precursor
Query= uniprot:A0KWY4 (313 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_611 Length = 322 Score = 315 bits (806), Expect = 1e-90 Identities = 170/322 (52%), Positives = 223/322 (69%), Gaps = 13/322 (4%) Query: 1 MKHNKIITALGLWAVSATCAYATT--------VGFSQVGSESGWRTSFSEAVKAEAKQRG 52 MK N+ A L +V +T +GFSQVG+ES WRT+ +E++K+ AK+ G Sbjct: 2 MKMNRRTVAAALASVPVAALLPSTAWAQKPLVLGFSQVGAESEWRTANTESIKSAAKEAG 61 Query: 53 IDLKFADAQQKQENQIKAVRSFIAQGVDAIIIAPVVETGWKPVLKEAKRAKIPVVIVDRN 112 I+LKF+DAQQKQENQIKA+RSFIAQ VD I +PVVE+GW+PVL+EAK AKIPVV+ DR Sbjct: 62 IELKFSDAQQKQENQIKAIRSFIAQKVDVIAFSPVVESGWEPVLREAKAAKIPVVLTDRA 121 Query: 113 IKVDDDSLFLTRIASDFSEEGRKIGQWLMDK---TQGNCDIAELQGTVGATAAIDRAAGF 169 + D SL++T + SDF EEGRK G+WL++K +G +I ELQGTVG+ AIDR GF Sbjct: 122 VNTKDTSLYVTFMGSDFVEEGRKAGRWLVEKMKDQKGEVNIVELQGTVGSAPAIDRKKGF 181 Query: 170 NQVIANYPNAKIVRSQTGEFTRAKGKEVMEGFLKAQNGQPLCAVWSHNDEMALGAVQAIK 229 ++I P KI+RSQTG+FTRAKGKEVME FLKA+ G+ + +++HND+MA+GA+QAI+ Sbjct: 182 EEIIKADPKFKIIRSQTGDFTRAKGKEVMEAFLKAE-GKKINVLYAHNDDMAIGAIQAIE 240 Query: 230 EAGLKPGKDILIVSVDGVPDYFKAMADGDVNATVELSPYLGGPAFDAIDAYLKGNKDQAK 289 EAG+KP KDI+I+S+D V F+AM G +N +VE SP L GP A +K K K Sbjct: 241 EAGMKPAKDIVIISIDAVKGAFEAMIAGKLNVSVECSPLL-GPQLMAAVKDIKAGKAVPK 299 Query: 290 LISTTGDVFTQETAAAEYEKRR 311 I T +F E AA E R+ Sbjct: 300 RIVTEEGIFPMEVAAKEMPNRK 321 Lambda K H 0.316 0.131 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 322 Length adjustment: 27 Effective length of query: 286 Effective length of database: 295 Effective search space: 84370 Effective search space used: 84370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory