Align Inner-membrane translocator (characterized, see rationale)
to candidate Ac3H11_3036 Fructose ABC transporter, permease component FrcC
Query= uniprot:A0KWY6 (405 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3036 Length = 319 Score = 140 bits (353), Expect = 5e-38 Identities = 102/301 (33%), Positives = 156/301 (51%), Gaps = 12/301 (3%) Query: 63 LWPLLALSILLLANLFIDSSFFNISYQDDRLYGSLIDILNRSAPVALLSIGMSLVIATGG 122 L P +AL +L F S +S Q+ L IL + VA+++IG +LVI T G Sbjct: 14 LGPFIAL--ILACAFFATQSERFLSAQNFAL------ILQQVMVVAVIAIGQTLVILTAG 65 Query: 123 IDLSVGAVMAIAGAVCANLLLVPDISLVTVIAAGLIVGLLAGCINGGLVSFLGIQPIVAT 182 IDLS G VMA+ G V + +S IA G+ V +L G ING LV+ + + P + T Sbjct: 66 IDLSCGMVMALGGIVMTKMAADYGLSAPVAIACGMAVTMLFGLINGLLVTKIKLPPFIVT 125 Query: 183 LLLMVAGRGVAQLINQGQIITFQHPGFAAIGVGQFLGLPMPVW---IVIGMLTFSQLLLR 239 L + QL + Q IT G A+G LG VW +++ + + LR Sbjct: 126 LGTLNIAFAATQLYSGAQTITDIPAGMTALGNTFQLGQTAIVWGAVLMLALYLVTWFALR 185 Query: 240 KTALGLFIEAVGCNAKASRYLGINDKSIKLFAYGIAGLCAALAGMISTADIQGSDANNAG 299 +TA G + AVG + +A+R GI + L Y +AGL +A ++S A D NAG Sbjct: 186 ETAPGRHVYAVGNSPEATRLTGIATDKVLLGVYVLAGLFYGIASLLSVARTGAGDP-NAG 244 Query: 300 LWLELDAVLAVVIGGAALTGGRFSLILSVVGALIIQTLATTIIVSGLPAKFNLLIKAIVI 359 LDA+ AVV+GG +L GGR ++ ++VGALI+ + + G+ + + +L+ I++ Sbjct: 245 QTENLDAISAVVLGGTSLFGGRGVILGTLVGALIVGVFRNGLTLMGVSSVYQILVTGILV 304 Query: 360 L 360 + Sbjct: 305 I 305 Lambda K H 0.323 0.136 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 319 Length adjustment: 29 Effective length of query: 376 Effective length of database: 290 Effective search space: 109040 Effective search space used: 109040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory