Align Inner-membrane translocator (characterized, see rationale)
to candidate Ac3H11_606 Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)
Query= uniprot:A0KWY6 (405 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_606 Length = 337 Score = 303 bits (776), Expect = 5e-87 Identities = 162/323 (50%), Positives = 222/323 (68%), Gaps = 6/323 (1%) Query: 61 RYLWPLLALSILLLANLFIDSSFFNISYQDDRLYGSLIDILNRSAPVALLSIGMSLVIAT 120 R WPL+ L++LL+ N +SSF +I ++D LYGSLIDILNR+AP+ L+S+GM+LVIAT Sbjct: 5 RLAWPLITLALLLVVNTVFNSSFLHIEWRDGHLYGSLIDILNRAAPLVLVSLGMTLVIAT 64 Query: 121 GGIDLSVGAVMAIAGAVCANLL------LVPDISLVTVIAAGLIVGLLAGCINGGLVSFL 174 GID+SVGA +AIA AV A ++ L I + V LL G NG LV+ + Sbjct: 65 RGIDISVGATVAIAAAVAAWMIGGSVSGTESRFPLPVAILGAIGVALLCGLWNGVLVAKV 124 Query: 175 GIQPIVATLLLMVAGRGVAQLINQGQIITFQHPGFAAIGVGQFLGLPMPVWIVIGMLTFS 234 G+QPI+ATL+LMVAGRG+AQLI GQIIT + + +G G GLP V++V + Sbjct: 125 GMQPIIATLILMVAGRGIAQLITDGQIITIYYTPYFFLGGGYLAGLPFSVFVVAAVFVAL 184 Query: 235 QLLLRKTALGLFIEAVGCNAKASRYLGINDKSIKLFAYGIAGLCAALAGMISTADIQGSD 294 L + +TALGLFI+AVG N A+R G+ + + AY G+CA +AG++ +++++ +D Sbjct: 185 YLAITRTALGLFIQAVGINPTAARVAGVQAGRLIVAAYVFCGVCAGIAGLLISSNVKSAD 244 Query: 295 ANNAGLWLELDAVLAVVIGGAALTGGRFSLILSVVGALIIQTLATTIIVSGLPAKFNLLI 354 NNAG LELDA+LAV +GG ALTGGRFSL+ SV+GALIIQTL I G+P + NL++ Sbjct: 245 GNNAGQLLELDAILAVTLGGTALTGGRFSLVGSVIGALIIQTLTYAIYSLGVPPEINLVV 304 Query: 355 KAIVILTVLLLQSAKFRRQLSAL 377 KA+V+ V+LLQS +FR Q+ AL Sbjct: 305 KAVVVFIVMLLQSPEFRAQVGAL 327 Lambda K H 0.323 0.136 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 337 Length adjustment: 30 Effective length of query: 375 Effective length of database: 307 Effective search space: 115125 Effective search space used: 115125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory