GapMind for catabolism of small carbon sources


Alignments for a candidate for glcB in Acidovorax sp. GW101-3H11

Align Malate synthase G (EC (characterized)
to candidate Ac3H11_4835 Malate synthase G (EC

Query= reanno::psRCH2:GFF353
         (726 letters)

          Length = 754

 Score =  958 bits (2477), Expect = 0.0
 Identities = 466/733 (63%), Positives = 590/733 (80%), Gaps = 12/733 (1%)

           MT+R  + GLQVA  L+ F+ ++ +PGTGV   AFW G D+++ DLAP+N ALLA+RD L

           Q ++D WH+A  G   + VAY+SFL++IGYL+P+  D +ATT NVD+E+A  AGPQLVVP








           GANTAWVPSPT ATLHA+HYH++ V   Q+EL K +  +  D     +LT+P+A   NWS


           GVVT+ QV  + +RMA VVD QN GDPLY+PMA +F  S+A++AA +LV +G +QP+GYT

Query: 710 EPVLHRRRREFKA 722
           EP+LH  R + KA
Sbjct: 738 EPLLHAWRLKLKA 750

Lambda     K      H
   0.316    0.133    0.386 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1569
Number of extensions: 71
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 726
Length of database: 754
Length adjustment: 40
Effective length of query: 686
Effective length of database: 714
Effective search space:   489804
Effective search space used:   489804
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 55 (25.8 bits)

Align candidate Ac3H11_4835 (Malate synthase G (EC
to HMM TIGR01345 (glcB: malate synthase G (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01345.hmm
# target sequence database:        /tmp/gapView.22699.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01345  [M=721]
Accession:   TIGR01345
Description: malate_syn_G: malate synthase G
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                        Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                        -----------
          0 1198.3   0.0          0 1198.1   0.0    1.0  1  lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4835  Malate synthase G (EC

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4835  Malate synthase G (EC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ! 1198.1   0.0         0         0       6     719 ..      26     750 ..      21     752 .. 0.97

  Alignments for each domain:
  == domain 1  score: 1198.1 bits;  conditional E-value: 0
                                        TIGR01345   6 grlqvakklkdfveeevlpgtgvdaekfwsgfdeivrdlapenrellakrdeiqaaideyhr 67 
                                                       +lqva+ l +f+e++vlpgtgv  e+fw+gfd+iv dlap+n  lla+rd++q+ +d +h+
                                                      689*********************************************************** PP

                                        TIGR01345  68 knkgvi.dkeayksflkeigylveepervtietenvdseiasqagpqlvvpvlnaryalnaa 128
                                                       n+g+i +  ay+sfl++igylv++p  v+ +t nvd+e+a+qagpqlvvp+lnaryalnaa
                                                      ***7761578**************************************************** PP

                                        TIGR01345 129 narwgslydalygsnvipeedgaekgkeynpkrgekviefarefldeslplesgsyadvvky 190
                                                      narwgslydalyg+++ipe+dgaekgk ynp+rg kvi+far+ ld++ pl sgs++d   y
                                                      ************************************************************** PP

                                        TIGR01345 191 kivdkklavqlesgkvtrlkdeeqfvgyrgdaadpevillktnglhielqidarhpigkadk 252
                                                      k+  ++l+v l +g++t lkd +qf+gy+g+aa+p+ +ll++nglh+++qid   pig++d 
                                                      ************************************************************** PP

                                        TIGR01345 253 akvkdivlesaittildcedsvaavdaedkvlvyrnllglmkgtlkeklekngriikrklne 314
                                                      a+v d+vle+a++tild+edsvaavdaedkvl+y+n+lg+ + tl e++ k g++i+r ln 
                                                      ************************************************************** PP

                                        TIGR01345 315 drsytaangeelslhgrsllfvrnvghlmtipviltde..g..eeipegildgvltsvialy 372
                                                      dr yt++ g e+ lhgrsl+f+rnvghlmt+p+il  +  g   eipegi+d+v+t++ial+
                                                      ********************************9964431233369***************** PP

                                        TIGR01345 373 dlkvq..nklrnsrkgsvyivkpkmhgpeevafanklftriedllglerhtlkvgvmdeerr 432
                                                      dl+ +  n +rnsrkgsvyivkpkmhgp ev fa +lf+r+e+llgl+  t+k+g+mdeerr
                                                      **97522679**************************************************** PP

                                        TIGR01345 433 tslnlkaciakvkervafintgfldrtgdeihtsmeagamvrkadmksapwlkayernnvaa 494
                                                      ts+nlkacia +  rvafintgfldrtgde+ht+m ag+mvrk+dmk+++w+++ye+nnv+ 
                                                      ************************************************************** PP

                                        TIGR01345 495 gltcglrgkaqigkgmwampdlmaemlekkgdqlragantawvpsptaatlhalhyhrvdvq 556
                                                      gl cglrgkaqigkgmwampdlmaeml++k+  ++agantawvpspt+atlhalhyh+v+v 
                                                      ************************************************************** PP

                                        TIGR01345 557 kvqkeladaerraelke....iltipvaentnwseeeikeeldnnvqgilgyvvrwveqgig 614
                                                       +q el +++ +ae+++    +lt+pva + nws+ e+++eldnn+qgilgyvvrwv+qg+g
                                                      *************97762222578************************************** PP

                                        TIGR01345 615 cskvpdihnvalmedratlrissqhlanwlrhgivskeqvleslermakvvdkqnagdeayr 676
                                                      cskvpdihnv lmedratlrissqhlanwl hg+v+  qv +++erma vvd qnagd+ y+
                                                      ************************************************************** PP

                                        TIGR01345 677 pmadnleasvafkaakdlilkgtkqpsgytepilharrlefke 719
                                                      pma+n+ +s+a+kaa dl++kg++qpsgytep+lha+rl+ k+
  lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4835 708 PMAGNFGTSMAYKAACDLVFKGMEQPSGYTEPLLHAWRLKLKA 750
                                                      ****************************************997 PP

Internal pipeline statistics summary:
Query model(s):                            1  (721 nodes)
Target sequences:                          1  (754 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.04u 0.02s 00:00:00.06 Elapsed: 00:00:00.06
# Mc/sec: 8.89

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory