Align Xylose/arabinose import permease protein XacH (characterized, see rationale)
to candidate Ac3H11_2064 ABC-type sugar transport system, permease component
Query= uniprot:D4GP36 (317 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2064 Length = 293 Score = 159 bits (403), Expect = 6e-44 Identities = 101/273 (36%), Positives = 148/273 (54%), Gaps = 6/273 (2%) Query: 43 FVLMSIAVYGGTGYNFAISFTDYEGLGTPDYSTLDLEMYAQALSSDAFIAAAQNNLVLLV 102 FVL +YG +N +S T L P+Y L Y + D + A +N + V Sbjct: 19 FVLGFAFIYGLMVWNGVLSLTVSRML--PNYEWAGLAQYERLWEMDRWWVALKNLGIFGV 76 Query: 103 GFTTICLVLGLFLAILLDHGIRFSEKFQTVYLLPMSLSFVVTAQLWLWMFNVESGILNLV 162 G+ L++G+ LA+LLD IR +T+YL PM+LSFVVT W W+ N GI +V Sbjct: 77 GYVGGSLLIGVVLAVLLDQKIRAEGALRTIYLYPMALSFVVTGTAWKWLLNPGLGIEKMV 136 Query: 163 VTTLGFNPVD--WLGNPSIALGAVILALIWQFSGYTMVVYLAGLQSIPDDQFEAARVDGA 220 GF + WL + +A+ V++A IWQ +G+ M ++LAGL+ I D +AA+VDGA Sbjct: 137 -RDWGFPNFEFGWLVDTEMAIYCVVIAGIWQSAGFAMALFLAGLRGIDDSIIKAAQVDGA 195 Query: 221 SITRTYLRIIVPQLKEASVSAAVVLMVFALKAFTFLYALVGRYRPPNGTDILATLMVRRA 280 S+ R Y RI++P L+ S +VL A+K+F + AL P TD+ AT M + Sbjct: 196 SLPRIYWRIVLPALRPVFFSTLMVLSHLAIKSFDLVMALTAG-GPGFATDVPATFMYTMS 254 Query: 281 FKFGEWAYSAAIATMLLIMALGVIGPYLYYQYK 313 F G+ AA ATM+L ++ PYLY + + Sbjct: 255 FSRGQIGLGAASATMMLATVAALVIPYLYSELR 287 Lambda K H 0.326 0.140 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 293 Length adjustment: 27 Effective length of query: 290 Effective length of database: 266 Effective search space: 77140 Effective search space used: 77140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory