Align Arginine ABC transporter permease protein ArtQ (characterized)
to candidate Ac3H11_3200 Amino acid ABC transporter permease protein
Query= SwissProt::P0AE34 (238 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3200 Length = 604 Score = 83.6 bits (205), Expect = 8e-21 Identities = 71/225 (31%), Positives = 110/225 (48%), Gaps = 12/225 (5%) Query: 6 PLASAAGMTVGLAVCALIVGLALAMFFAVWESAKWRPVAWAGSALVTILRGLPEILVVLF 65 P+ G T+ L + G L A+ ++ +A + I R +P ++V+L Sbjct: 81 PVLVGLGRTLLLTALGALFGFTLGTALALARVSRSPLLAGLSWTFIWIFRSIP-VIVLLL 139 Query: 66 IYFGSSQLLLTLSDG--FTINLGFVQIPVQMDIENFDVSPFLCGVIALSLLYAAYASQTL 123 I L T+S G FT F Q+ +SPF+ +I L+L AA+AS+ + Sbjct: 140 IINNLGYLYETVSVGLPFTDWTFFSYPTTQL------ISPFVAALIGLTLNQAAFASEIV 193 Query: 124 RGALKAVPVGQWESGQALGLSKSAIFFRLVMPQMWRHALPGLGNQWLVLLKDTALVSLIS 183 RG + +V GQ E+ ALGL + FR+V+PQ R LP N + L K T+ V +++ Sbjct: 194 RGGILSVDQGQLEAAAALGLPRRRQAFRIVLPQAMRSILPAGFNDIIGLAKGTSNVYILA 253 Query: 184 VNDLMLQTKSIATRTQEPFTWYIVAAAIYLVI-TLLS--QYILKR 225 + +L + I R E +VA YLVI T+LS QY ++R Sbjct: 254 LPELFYTIQIIYRRNLEVIPLLMVATVWYLVILTVLSLLQYYIER 298 Lambda K H 0.328 0.139 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 604 Length adjustment: 30 Effective length of query: 208 Effective length of database: 574 Effective search space: 119392 Effective search space used: 119392 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory