Align 4-guanidinobutyramide hydrolase; SubName: Full=Carbon-nitrogen hydrolase (characterized, see rationale)
to candidate Ac3H11_1207 FIG003879: Predicted amidohydrolase
Query= uniprot:A0A291T0X0 (265 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1207 Length = 272 Score = 74.3 bits (181), Expect = 2e-18 Identities = 81/253 (32%), Positives = 107/253 (42%), Gaps = 17/253 (6%) Query: 21 NLKVLDEAAARAAADGAGLLVTAEMF-LTGYAIGGGVRDLAEPADGPSGRAVADIAAAHG 79 NL+ AA GA L V E F + G+ + DG R +AD A A Sbjct: 17 NLRAARALLEEAALGGAELAVLPEYFCVMGHKDTDKLALREADGDGVIQRFLADTARALK 76 Query: 80 LAILYGYPERHAGA---VHNSARLVGADGTELANYRKTHLYGCF-------ERASFTPGE 129 + I+ G A V N+ + G +A Y K HL+ E G Sbjct: 77 MWIVGGTLPLQTTAPDRVRNTTLVFSPTGDCVARYDKIHLFHFDNGRELYDEGRVIEAGN 136 Query: 130 TPV---VQATVGEL-TVGILVCYDVEFPENVRAHALAGTDLLLVPTAQMHPF-EFVAESL 184 TPV +QA G+ VG+ VCYD+ FPE RAHA AG DLLLVP+A H + E L Sbjct: 137 TPVQFDLQARDGQRWRVGLSVCYDLRFPELYRAHARAGADLLLVPSAFTHTTGQAHWEVL 196 Query: 185 IPVRAFESQMYIAYVNRSG-PEGEFDFVGLSCLAGPDGATCLRAGRGEELLLGDVDPKLL 243 + RA E+ Y+ + G E G S L P G + +G + G +D + L Sbjct: 197 LRARAIENLAYVLAPAQGGVHENGRHTWGRSMLVDPWGTVLAQQDQGPGTVTGVLDAERL 256 Query: 244 TTSRRINPYLRDR 256 R P L R Sbjct: 257 RAVRAQLPALTHR 269 Lambda K H 0.319 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 272 Length adjustment: 25 Effective length of query: 240 Effective length of database: 247 Effective search space: 59280 Effective search space used: 59280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory