Align Gamma-glutamyl-putrescine synthetase (EC 6.3.1.11) (characterized)
to candidate Ac3H11_1551 Glutamine synthetase type I (EC 6.3.1.2)
Query= reanno::pseudo1_N1B4:Pf1N1B4_2254 (426 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1551 Length = 435 Score = 154 bits (389), Expect = 5e-42 Identities = 124/400 (31%), Positives = 187/400 (46%), Gaps = 31/400 (7%) Query: 43 GLGLDIGDADRICYPIPDTLCNEPWQKRPTAQLLMTMHELEGDPFFADPREVLRQVVAKF 102 G+G+ + + D++ PW TA + + ++G P DPR +L++ +AKF Sbjct: 45 GMGMGPNGREFMAVGDRDSIRPVPWMGS-TASVTCEGY-VDGKPHALDPRVILKKALAKF 102 Query: 103 DEM-GLTICAAFELEFYLIDQENVNGRPQPPRSPISGKRPHSTQVYLIDDLDEYVDCLQD 161 E GL E EF+L+ G S +P Y L D L + Sbjct: 103 RETTGLEFFTGLEPEFFLLKAGAAAGSWVVATESESLDKP----CYDFRHLSSVSDFLME 158 Query: 162 ILEGAKEQGIPADAIVKESAPAQFEVNLHHVADPIKACDYAVLLKRLIKNIAYDHEMDTT 221 + +E GI I E A QFE+N + AD +K D K + IA H M + Sbjct: 159 LRAALEEAGIDVYQIDHEDANGQFEMNFTY-ADALKTADNLTYFKMAAQAIAKKHGMLCS 217 Query: 222 FMAKPYPGQAGNGLHVHISILDKDGKNIFASE-DPEQ---NAALRHAIGGVLETLPAQMA 277 FM KP+ ++G+GLH+H+S + N F + DP + + +GG++ A A Sbjct: 218 FMPKPFAERSGSGLHMHMSAGGEFCDNAFEDKTDPREMDLSPMAYQFLGGLMANAAALTA 277 Query: 278 FLCPNVNSYRRF------GAQFYVPNSPCWGLDNRTVAIRVPTGSSDAVRIEHRVAGADA 331 P VNSY+R + P + +G +NRT +RVP G R+E R+ A A Sbjct: 278 IAAPCVNSYKRLVKSGSRSGATWAPINIAYGNNNRTALVRVPGG-----RLELRLPDAAA 332 Query: 332 NPYLLMASVLAGVHHGLTNKIEPGAPVEGNSYEQNE--------QSLPNNLRDALRELDD 383 NPYLL A+V+ G+ ++EPG PV N Y + + LP +L DAL ELD Sbjct: 333 NPYLLTAAVIYAGLDGIERELEPGQPVNDNLYVLSVADLAALGIKCLPTSLPDALDELDA 392 Query: 384 SEVMAKYIDPKYIDIFVACKESELEEFEHSISDLEYNWYL 423 SEVM + + +I ++A K +E +E IS E+ Y+ Sbjct: 393 SEVMRRGLGEAFIAEYLAVKRAECDELVLEISKAEFTRYV 432 Lambda K H 0.318 0.137 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 503 Number of extensions: 33 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 435 Length adjustment: 32 Effective length of query: 394 Effective length of database: 403 Effective search space: 158782 Effective search space used: 158782 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory