Align PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized)
to candidate Ac3H11_4900 Putative amino acid ABC transporter, permease protein
Query= TCDB::Q88NY3 (248 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4900 Length = 217 Score = 105 bits (262), Expect = 7e-28 Identities = 66/207 (31%), Positives = 114/207 (55%), Gaps = 13/207 (6%) Query: 31 WTIAIAITAWIIALLLGSLLGVMRTVPNRLVSGIATAYVELFRNVPLLVQLFIWYFLVPD 90 WT+++++ A+I L+G LL V+R R V AYV++F+ PLL+QLF+ YF + Sbjct: 19 WTVSLSLIAFIGGGLVGLLLLVLRLSKVRGVDRAVGAYVQVFQGTPLLMQLFLAYFGIA- 77 Query: 91 LLPEGLQEWFKQDLNPTTSALISVVICLGLFTAARVCEQVRTGIQALPKGQEAAARAMGF 150 F +P T+A ++ L L+T+A + E R + ++PKGQ AA+++ F Sbjct: 78 --------LFGIKTSPWTAAAVA----LTLYTSAYLTEIWRGCVASIPKGQWEAAQSLAF 125 Query: 151 SLPQIYNNVLLPQAYRIIIPPLTSEFLNVFKNSSVASLIGLMELLAQTKQTAEFSANLFE 210 + + +V+LPQA RI +PP + V K +++AS+IG +EL + + F Sbjct: 126 NFGEQLRHVVLPQALRIAVPPTVGFLVQVIKGTALASVIGFVELTKAGSMISNATYKPFL 185 Query: 211 AFTLATLIYFTLNMGLMLLMRMVEKKV 237 + L+YF L + L+ + +E+K+ Sbjct: 186 VYACVALLYFVLCFPVSLVAQSLERKL 212 Lambda K H 0.325 0.139 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 217 Length adjustment: 23 Effective length of query: 225 Effective length of database: 194 Effective search space: 43650 Effective search space used: 43650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory