Align ATPase (characterized, see rationale)
to candidate Ac3H11_3327 Glutamine transport ATP-binding protein GlnQ (TC 3.A.1.3.2)
Query= uniprot:Q31RN8 (261 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3327 Length = 249 Score = 256 bits (654), Expect = 3e-73 Identities = 133/225 (59%), Positives = 162/225 (72%) Query: 36 QALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWIEGHRLSHDRRDIAT 95 Q L VS T GEV V++G SGSGKST LR +N LE H G I I G + D+ + Sbjct: 23 QVLKDVSTTFNTGEVTVIIGASGSGKSTLLRAINRLEPHDSGTITIGGEPVGDDQHLLQK 82 Query: 96 IRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQLLERVRIAEQADKYP 155 R EVGMVFQQFNLF H++VL N+ LAP ++R P QA A A LL RV + + A KYP Sbjct: 83 QRSEVGMVFQQFNLFGHMSVLDNVTLAPRRIRHTPRTQANAQALALLTRVGMQDHAHKYP 142 Query: 156 GQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDVMRDLASEGMTMLVATH 215 QLSGGQQQRVAIARALAMQP+++LFDEPTSALDPEMV+EVLDVMR+LA GMTM+V TH Sbjct: 143 WQLSGGQQQRVAIARALAMQPKVMLFDEPTSALDPEMVQEVLDVMRELARGGMTMIVVTH 202 Query: 216 EVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRAKQFLAQI 260 E+GFAREV+DRV+ G+I +APP FF P +DR + F+ ++ Sbjct: 203 EMGFAREVSDRVMFFDQGRIAHDAPPAEFFNNPANDRIRAFIGRM 247 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 249 Length adjustment: 24 Effective length of query: 237 Effective length of database: 225 Effective search space: 53325 Effective search space used: 53325 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory