Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate Ac3H11_1958 Glutamate Aspartate transport ATP-binding protein GltL (TC 3.A.1.3.4)
Query= TCDB::Q52666 (263 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1958 Length = 245 Score = 271 bits (694), Expect = 7e-78 Identities = 137/244 (56%), Positives = 180/244 (73%), Gaps = 3/244 (1%) Query: 23 IQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGKIIVD 82 I++ ++KWYG VL + + T+++GE +V+ GPSGSGKST+I+ IN LE Q G+I VD Sbjct: 2 IELKNVSKWYGPVQVLNECSATINKGEVVVVCGPSGSGKSTLIKTINALEPFQKGEITVD 61 Query: 83 GIELTSDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKREAEETAMYYL 142 G++L N+ K+RS VGMVFQHF LFPHL++ +NLT+A I V EA++ + L Sbjct: 62 GVKLHDPSTNLPKLRSRVGMVFQHFELFPHLSVTDNLTIAQIKVLGRSADEAKKRGLKML 121 Query: 143 EKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIKEVLDTMIQ 202 E+V + K+PGQLSGGQQQRVAIAR+L M P +MLFDEPTSALDPEM+ EVLD M+ Sbjct: 122 ERVGLIAHKDKFPGQLSGGQQQRVAIARALSMDPIVMLFDEPTSALDPEMVGEVLDVMVG 181 Query: 203 LAEEGMTMLCVTHEMGFAQAVANRVIFM-ADGQIVEQNNPHDFFHNPQSE--RTKQFLSQ 259 LA EGMTM+CVTHEMGFA+ V+NRVIFM G+I+E + +FF+NP + RTK FL++ Sbjct: 182 LANEGMTMMCVTHEMGFARKVSNRVIFMDVGGKILEDCSKDEFFNNPDARQPRTKDFLNK 241 Query: 260 ILGH 263 IL H Sbjct: 242 ILAH 245 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 245 Length adjustment: 24 Effective length of query: 239 Effective length of database: 221 Effective search space: 52819 Effective search space used: 52819 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory