Align NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized)
to candidate Ac3H11_3326 Amino acid ABC transporter, permease protein
Query= TCDB::Q8YPM8 (308 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3326 Length = 260 Score = 110 bits (275), Expect = 4e-29 Identities = 77/237 (32%), Positives = 125/237 (52%), Gaps = 31/237 (13%) Query: 72 TDTYSLALWVGLINSLRIAFVGIILTTIVGILAGIARLSDNWLVRNISLVYVEIFRNTPL 131 +D LW+ LI+ VG++L G A +AR + +VR + Y+ + R TPL Sbjct: 53 SDGARTTLWLTLISGS----VGLVL----GTGAALARTARWAVVRWAASFYIWVIRGTPL 104 Query: 132 LLQLLFWYFAVFLGLPRADNKISLGGFIGLSQNGLELPWFTFSPEFSALLLGLIFYTGAF 191 L+Q+LF YFA+ + +P GL LP +F+A +L L GA+ Sbjct: 105 LVQILFVYFALPVLVP-----------------GLNLP------DFAAAVLALGLNVGAY 141 Query: 192 IAEIVRGGIQSVSKGQWEAGRSLGLNPSLIMRLVIFPQALRVIIPPLTSQYLNLTKNSSL 251 AE +R G+ +V +GQ EA ++LGL + V+FPQA ++ +PPL S ++ L K+SSL Sbjct: 142 NAEAIRAGLLAVPRGQTEAAKALGLGRMHVFFDVVFPQAFKISLPPLVSNFVALLKDSSL 201 Query: 252 AIAIGYPDIYFVASTTFNQTGKAVEVMLLLMLTYLSLSLTISLIMNAFNRTVQIKER 308 A AIG ++ V + + T + + + + +TYL L+ ++ I NA ++ R Sbjct: 202 AYAIGVVELTNVGNRIQSATFQPIATLSTVAITYLLLTTLVTQISNAVEYRFDVEGR 258 Lambda K H 0.328 0.143 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 260 Length adjustment: 26 Effective length of query: 282 Effective length of database: 234 Effective search space: 65988 Effective search space used: 65988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory