Align AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)
to candidate Ac3H11_3326 Amino acid ABC transporter, permease protein
Query= TCDB::Q52813 (400 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3326 Length = 260 Score = 97.4 bits (241), Expect = 4e-25 Identities = 87/247 (35%), Positives = 125/247 (50%), Gaps = 27/247 (10%) Query: 145 LLVIFFWYLG-VLSVLPQPRESVGLPFSMYLNNRGLAFPKPIFDTGMIAVGIALVIAIVA 203 L+V+ LG +LS LP+P S FS + +I+ + LV+ A Sbjct: 26 LMVLALALLGQLLSFLPEPIGSNAQAFS--------DGARTTLWLTLISGSVGLVLGTGA 77 Query: 204 SII-IARWAHKRQAATGQPFHTVWTAIALIVGLPLLVFVVSGFPLTFDVPVAGKFNLTGG 262 ++ ARWA R AA+ +W +I G PLLV ++ + F +PV L G Sbjct: 78 ALARTARWAVVRWAAS----FYIW----VIRGTPLLVQILFVY---FALPV-----LVPG 121 Query: 263 SVVGPEFMSLFLALSFYTASFIAEIVRGGIRGVPKGQSEAAGALGLHPSSVTRLVVVPQA 322 + P+F + LAL ++ AE +R G+ VP+GQ+EAA ALGL V VV PQA Sbjct: 122 LNL-PDFAAAVLALGLNVGAYNAEAIRAGLLAVPRGQTEAAKALGLGRMHVFFDVVFPQA 180 Query: 323 LRIIIPPLTSQYLNLTKNSSLAIAIGFSDLVAVGGTILNQSGQAIEIVCIWGIVYLSLSI 382 +I +PPL S ++ L K+SSLA AIG +L VG I + + Q I + I YL L+ Sbjct: 181 FKISLPPLVSNFVALLKDSSLAYAIGVVELTNVGNRIQSATFQPIATLSTVAITYLLLTT 240 Query: 383 LTSLFMN 389 L + N Sbjct: 241 LVTQISN 247 Lambda K H 0.327 0.141 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 260 Length adjustment: 28 Effective length of query: 372 Effective length of database: 232 Effective search space: 86304 Effective search space used: 86304 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory