Align PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized)
to candidate Ac3H11_1956 Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)
Query= TCDB::Q88NY3 (248 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1956 Length = 252 Score = 209 bits (532), Expect = 4e-59 Identities = 108/255 (42%), Positives = 158/255 (61%), Gaps = 22/255 (8%) Query: 4 NWDWGVFFKST----------GVGSE-TYLDWYITGLGWTIAIAITAWIIALLLGSLLGV 52 +WDW VF + T G G + TYLDW ++ GWT+++++ A ++AL+LGSL+G Sbjct: 2 SWDWQVFCQDTMDREVVQSCFGKGGDITYLDWMLSAWGWTVSVSLLALVLALVLGSLIGT 61 Query: 53 MRTVPNR-LVSGIATAYVELFRNVPLLVQLFIWYFLVPDLLPEGLQEWFKQDLNPTTSAL 111 +RT+ +R ++ + A+VELFRN+PLLVQ+F+WY ++P L P + Sbjct: 62 LRTLQDRPMIVRLGNAWVELFRNIPLLVQIFLWYHVIPSLFP----------VMKGVPGF 111 Query: 112 ISVVICLGLFTAARVCEQVRTGIQALPKGQEAAARAMGFSLPQIYNNVLLPQAYRIIIPP 171 VV+ LG FT+AR+ EQVR+GIQALP+GQ A A+GF+ Q Y VLLP A+RIIIPP Sbjct: 112 ALVVLALGFFTSARIAEQVRSGIQALPRGQRYAGMAVGFTTFQTYRYVLLPMAFRIIIPP 171 Query: 172 LTSEFLNVFKNSSVASLIGLMELLAQTKQTAEFSANLFEAFTLATLIYFTLNMGLMLLMR 231 LTSE +N+FKNSSVA + + EL Q E ++ E + T +Y + +M Sbjct: 172 LTSETMNIFKNSSVAFAVSVAELTMFAMQAQEETSRGIEVYLAVTSLYIISAFAINRIMA 231 Query: 232 MVEKKVAVPGLISVG 246 +EK+V +PG++ G Sbjct: 232 FIEKRVRIPGMVVAG 246 Lambda K H 0.325 0.139 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 252 Length adjustment: 24 Effective length of query: 224 Effective length of database: 228 Effective search space: 51072 Effective search space used: 51072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory