Align NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized)
to candidate Ac3H11_2554 Amino acid ABC transporter, permease protein
Query= TCDB::Q8YPM8 (308 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2554 Length = 222 Score = 116 bits (291), Expect = 4e-31 Identities = 73/219 (33%), Positives = 119/219 (54%), Gaps = 26/219 (11%) Query: 79 LWVGLINSLRIAFVGIILTTIVGILAGIARLSDNW-LVRNISLVYVEIFRNTPLLLQLLF 137 L G + ++ I ++L ++G+L GI RL+ +V + YV R TPLL+QL Sbjct: 15 LLAGALVTVEITAASLLLGCVMGLLVGIGRLNPKRRVVYALCTAYVAAIRGTPLLVQL-- 72 Query: 138 WYFAVFLGLPRADNKISLGGFIGLSQNGLELPWFTFSPEFSALLLGLIFYTGAFIAEIVR 197 F +F GLP Q G+ LP F ++GL Y+GA+++E+VR Sbjct: 73 --FILFFGLP---------------QFGILLPAFVCG------VIGLGIYSGAYVSEVVR 109 Query: 198 GGIQSVSKGQWEAGRSLGLNPSLIMRLVIFPQALRVIIPPLTSQYLNLTKNSSLAIAIGY 257 G IQS+ KGQ EA RS+G++ L MR V+ PQA+ +IPPL ++++ L KNS+L + Sbjct: 110 GAIQSIDKGQMEAARSIGMSSGLAMRTVVLPQAVVRMIPPLGNEFIALIKNSALVSLLTI 169 Query: 258 PDIYFVASTTFNQTGKAVEVMLLLMLTYLSLSLTISLIM 296 D+ + + +++EV L + + Y L+ +L++ Sbjct: 170 HDLMHEGQKIISVSYRSLEVYLAIAVVYFILTGATTLVL 208 Lambda K H 0.328 0.143 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 222 Length adjustment: 25 Effective length of query: 283 Effective length of database: 197 Effective search space: 55751 Effective search space used: 55751 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory