Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate Ac3H11_2599 Glyoxylate reductase (EC 1.1.1.79) / Glyoxylate reductase (EC 1.1.1.26) / Hydroxypyruvate reductase (EC 1.1.1.81); 2-ketoaldonate reductase, broad specificity (EC 1.1.1.215) (EC 1.1.1.-)
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2599 Length = 329 Score = 226 bits (577), Expect = 4e-64 Identities = 144/324 (44%), Positives = 191/324 (58%), Gaps = 12/324 (3%) Query: 3 KIVAWKSLPEDVLAYLQQHAQVVQVDATQHDAF------VAALKDADGGIGS-SVKITPA 55 +I+ +++ D++ L++H V+A D A L D DG + + S +I A Sbjct: 5 RILVARAIFPDIVDRLREH---FDVEANPDDVIWTPQELAARLADKDGVLTTGSQRIDAA 61 Query: 56 MLEGATRLKALSTISVGFDQFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRVV 115 +L A RLK + ++VG++ FDV +T G+ NTPDVLTE+TAD F+L++A+ARR+ Sbjct: 62 LLAAAPRLKICANMAVGYNNFDVDAMTAAGVQGTNTPDVLTETTADFGFALLMATARRMT 121 Query: 116 ELAEWVKAGHWQHSIGPALFGVDVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRS- 174 E +++AG W G D+ G TLGI+G+GRIG +A+R A GF MKV+Y NRS Sbjct: 122 ESEHYLRAGQWTKWSYDMFAGSDIHGSTLGIIGMGRIGQGIAKRGAHGFGMKVIYHNRSR 181 Query: 175 ANPQAEEAYGARRVELAELLATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRG 234 + + E A V ELL TAD V L VP T + H IGAAEL MK +A LIN +RG Sbjct: 182 LSAELEAECKASYVGKDELLRTADHVMLVVPYTAASHHTIGAAELALMKPTATLINIARG 241 Query: 235 ATVDEKALIEALQNGTIHGAGLDVFETEPLPSDSPLLKLANVVALPHIGSATHETRHAMA 294 VD+ AL AL+ G I AGLDVFE EP LL + NVV PHI SAT TR AMA Sbjct: 242 GIVDDAALAVALREGRIAAAGLDVFEGEP-SVHPDLLTVPNVVLTPHIASATVPTRRAMA 300 Query: 295 RNAAENLVAALDGTLTSNIVNREV 318 AA+NL+A L G VN+ V Sbjct: 301 NLAADNLIAFLGGRGPLTPVNQPV 324 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 232 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 329 Length adjustment: 28 Effective length of query: 293 Effective length of database: 301 Effective search space: 88193 Effective search space used: 88193 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory