Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate Ac3H11_990 Iron(III) dicitrate transport ATP-binding protein FecE (TC 3.A.1.14.1)
Query= CharProtDB::CH_088321 (255 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_990 Length = 244 Score = 132 bits (333), Expect = 5e-36 Identities = 85/226 (37%), Positives = 123/226 (54%), Gaps = 3/226 (1%) Query: 18 LNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQS--GTVFLGDNPINMLSSRQLA 75 L + L LP G+ T+++GPNG GKSTLL + LL + G V L P+ + +R+ A Sbjct: 1 LQGIDLQLPAGRWTSIVGPNGAGKSTLLKVLAGLLPRAAVQGEVQLLGRPLAQIPARERA 60 Query: 76 RRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVAMNQTRINHLAVRR 135 R+L+ L Q+ + + +T ++ GR P + A D+A V A+ T+ R Sbjct: 61 RQLAWLGQNEGSADDLTSYDVAMLGRLPHQAWLAPPGAADHAAVEQALRTTQAWDWRHRP 120 Query: 136 LTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRLMGELRTQGKTVVAVL 195 L++LSGG+RQR LA LA V+L+DEP LD HQ D + M L G TVV+VL Sbjct: 121 LSQLSGGERQRVLLARALAVQAQVLLMDEPLANLDPPHQTDWLHTMRALVEAGGTVVSVL 180 Query: 196 HDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVEAEI 241 H+++ A + D +VVMANG V+ QG T L VF ++ Sbjct: 181 HEVSLALQ-ADDMVVMANGRVLHQGACGAPATHAALEEVFDHRIQV 225 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 244 Length adjustment: 24 Effective length of query: 231 Effective length of database: 220 Effective search space: 50820 Effective search space used: 50820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory