Align TctC aka STM2786, component of The tricarboxylate transporter, TctABC (characterized)
to candidate Ac3H11_112 Tricarboxylate transport protein TctC
Query= TCDB::Q9FA46 (325 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_112 Length = 345 Score = 289 bits (740), Expect = 6e-83 Identities = 141/295 (47%), Positives = 196/295 (66%), Gaps = 1/295 (0%) Query: 30 ECIAPAKPGGGFDLTCKLIQVSLLETGAIEKPMRVTYMPGGVGAVAYNAIVAQRPGEPGT 89 ECIAP++PGGGFDLTC L ++ P+ Y+PGG+GAVA++ + R G PGT Sbjct: 46 ECIAPSRPGGGFDLTCGLATQAVQVVRPARPPLHTRYLPGGIGAVAFDQVATGRLGGPGT 105 Query: 90 VVAFSGGSLLNLSQGKFGRYGVDDVRWLASVGTDYGMIAVRADSPWKTLKDLMTAMEKDP 149 +VAFS GSLLN++QG+FG + V VRW+A++GTDYG++AV D+P + L+D++ A+ KDP Sbjct: 106 LVAFSSGSLLNIAQGRFGPHPVSAVRWIATLGTDYGVVAVHRDAPHQRLQDVVAALRKDP 165 Query: 150 NSVVIGAGASIGSQDWMKSALLAQKANVDPHKMRYVAFEGGGEPVTALMGNHVQVVSGDL 209 VV GAG ++GSQDWMK+ALL + A DP +MR+V+FEGGGE + AL G H+ V +GD Sbjct: 166 ARVVFGAGGTLGSQDWMKAALLTRAAGQDPKRMRFVSFEGGGEALKALRGGHIGVFTGDA 225 Query: 210 SEMVPYL-GGDKIRVLAVFSENRLPGQLANIPTAKEQGYDLVWPIIRGFYVGPKVSDADY 268 +E L G +R LAV ++ RLPG LA++PTA+EQG DLVWP +RG Y+ DA Sbjct: 226 AEARQALEKGAPLRFLAVLAQARLPGALADLPTAREQGVDLVWPTVRGLYMAASAPDAAV 285 Query: 269 QWWVDTFKKLQQTDEFKKQRDLRGLFEFDMTGQQLDDYVKKQVTDYREQAKAFGL 323 + WV F + GL+ F TG L+ +V++ + DYR+ A+ GL Sbjct: 286 RAWVTAFADALAAPGYAALCGQYGLYPFARTGAALEAFVQRSLADYRQLAQELGL 340 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 412 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 345 Length adjustment: 28 Effective length of query: 297 Effective length of database: 317 Effective search space: 94149 Effective search space used: 94149 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory